Table Of Contents
Peptide Modifications¶
glycresoft supports the full range of UNIMOD
modification rules as well as some common alternative namings. Targeting rules listed in this table are the known
specificities from the database, but arbitrary targets may be specified.
Additionally, custom modifications may be specified using the syntax @<name>-<mass>, e.g. @custom modification-410.5
for a modification “custom modification” with a mass delta of +410.5 Da, or @Antimatter--99999 for a modification with the
name “Antimatter” with a mass delta of -99999.0 Da.
UNIMOD¶
Warning
If you wish to specify a glycan modification, please use GlycReSoft’s system for glycan compositions, not UNIMOD’s.
UNIMOD |
Name |
Mass |
Other Names |
Targets |
|---|---|---|---|---|
UNIMOD:1 |
Acetyl |
42.010565 |
Acetylation |
H, C, N-term, K, S, T, R, Y |
UNIMOD:2 |
Amide |
-0.984016 |
Amidation, Top-Down sequencing c-type fragment ion, Amidated |
C-term |
UNIMOD:3 |
Biotin |
226.077598 |
Biotinylation |
N-term, K |
UNIMOD:4 |
Carbamidomethyl |
57.021464 |
Carboxyamidomethylation, Iodoacetamide derivative |
H, C, N-term, M, K, U, D, S, T, E, Y |
UNIMOD:5 |
Carbamyl |
43.005814 |
Carbamylation |
C, N-term, M, K, S, T, R, Y |
UNIMOD:6 |
Carboxymethyl |
58.005479 |
Iodoacetic acid derivative, Carboxymethylation |
C, N-term, K, U, W |
UNIMOD:7 |
Deamidated |
0.984016 |
Deamidation, Citrullination, phenyllactyl from N-term Phe |
N, F @ Protein N-term, R, Q |
UNIMOD:8 |
ICAT-G |
486.251206 |
Gygi ICAT(TM) d0, Gygi_ICATd0 |
C |
UNIMOD:9 |
Gygi_ICATd8 |
494.30142 |
Gygi ICAT(TM) d8, ICAT-G:2H(8) |
C |
UNIMOD:10 |
HSe |
-29.992806 |
Homoserine, Met->Hse |
M @ C-term |
UNIMOD:11 |
Met->Hsl |
-48.003371 |
Homoserine lactone, Hse_lact |
M @ C-term |
UNIMOD:12 |
ICAT-D:2H(8) |
450.275205 |
Applied Biosystems original ICAT(TM) d8, AB_old_ICATd8 |
C |
UNIMOD:13 |
ICAT-D |
442.224991 |
AB_old_ICATd0, Applied Biosystems original ICAT(TM) d0 |
C |
UNIMOD:17 |
NIPCAM |
99.068414 |
Dimethylacrylamide, DMA, N-isopropylcarboxamidomethyl |
C |
UNIMOD:20 |
PEO-Biotin |
414.193691 |
Pierce EZ-Link PEO-Iodoacetyl Biotin, Biotinyl-iodoacetamidyl-3,6-dioxaoctanediamine, PEO-Iodoacetyl-LC-Biotin |
C |
UNIMOD:21 |
Phospho |
79.966331 |
Phosphorylation |
H, C, K, TYS, S, D, TS, T, R, E, Y |
UNIMOD:23 |
Dehydrated |
-18.010565 |
C-terminal imide, Phospho+PL, Dehydration, didehydroalanine, D-Succinimide, Prompt loss of phosphate from phosphorylated residue |
C @ N-term, N @ Protein C-term, S, D, T, Q @ Protein C-term, Y |
UNIMOD:24 |
Propionamide |
71.037114 |
Acrylamide adduct |
N-term, K, C |
UNIMOD:25 |
pyridylacetyl |
119.037114 |
Pyridylacetyl |
N-term, K |
UNIMOD:26 |
Pyro-cmC |
39.994915 |
Carbamidomethyl-Cys cyclization (N-terminus), Pyro-carbamidomethyl, S-carbamoylmethylcysteine cyclization (N-terminus), Carboxymethyl-Cys cyclization (N-terminus) |
C @ N-term |
UNIMOD:27 |
Pyro_glu |
-18.010565 |
Glu->pyro-Glu, Pyro-glu from E |
E @ N-term |
UNIMOD:28 |
Pyro-glu |
-17.026549 |
Gln->pyro-Glu, Pyro-glu from Q |
Q @ N-term |
UNIMOD:29 |
SMA |
127.063329 |
N-Succinimidyl-2-morpholine acetate |
N-term, K |
UNIMOD:30 |
Sodiated |
21.981943 |
Sodium adduct, Cation:Na |
C-term, D, E |
UNIMOD:31 |
Pyridylethyl |
105.057849 |
S-pyridylethylation, S-pyridylethyl |
C |
UNIMOD:34 |
Methyl |
14.01565 |
methyl ester, Methylation |
H, C, N-term, N, C-term, K, D, S, T, R, E, I, Q, L |
UNIMOD:35 |
Oxidation |
15.994915 |
Hydroxylation, Oxidation or Hydroxylation |
V, N, D, F, W, T, C, M, K, P, S, R, E, I, Y, L, H, U, G @ C-term, Q |
UNIMOD:36 |
Dimethyl |
28.0313 |
di-Methylation |
N-term, N, K, P @ Protein N-term, R |
UNIMOD:37 |
Trimethyl |
42.04695 |
tri-Methylation |
K, R, A @ Protein N-term |
UNIMOD:39 |
MMTS |
45.987721 |
b-methylthiol, Methyl methanethiosulfonate, Methylthio, Beta-methylthiolation |
C, N-term, N, K, D |
UNIMOD:40 |
Sulfo |
79.956815 |
Sulfation, O-Sulfonation |
S, Y, T, C |
UNIMOD:41 |
Hex |
162.052824 |
Hexose, Mannose, Galactose, Fructose, Glucose |
C, N-term, N, K, S, W, T, R, Y |
UNIMOD:42 |
Lipoyl |
188.032956 |
K |
|
UNIMOD:43 |
HexNAc |
203.079373 |
N-Acetylhexosamine |
S, N, T |
UNIMOD:44 |
Farnesyl |
204.187801 |
Farnesylation |
C |
UNIMOD:45 |
Myristoyl |
210.198366 |
Myristoylation |
K, G @ N-term, C |
UNIMOD:46 |
Pyridoxal-phos |
229.014009 |
Pyridoxal phosphate, PyridoxalPhosphate |
K |
UNIMOD:47 |
Palmitoyl |
238.229666 |
Palmitoylation |
C, N-term, K, S, T |
UNIMOD:48 |
GeranylGeranyl |
272.250401 |
Geranyl-geranyl |
C |
UNIMOD:49 |
p-pantetheine |
340.085794 |
Phosphopantetheine |
S |
UNIMOD:50 |
FAD |
783.141486 |
Flavin adenine dinucleotide |
Y, H, C |
UNIMOD:51 |
Tripalmitate |
788.725777 |
N-acyl diglyceride cysteine |
C @ Protein N-term |
UNIMOD:52 |
Guanidinyl |
42.021798 |
homoarginine, Guanidination |
N-term, K |
UNIMOD:53 |
HNE |
156.11503 |
4-hydroxynonenal (HNE) |
H, C, K, A, L |
UNIMOD:54 |
Glucuronyl |
176.032088 |
hexuronic acid, glucuronosyl, N-glucuronyl |
N-term, S, T |
UNIMOD:55 |
Glutathione |
305.068156 |
glutathione disulfide |
C |
UNIMOD:56 |
Acetyl_heavy |
45.029395 |
Acetate labeling reagent (N-term & K) (heavy form, +3amu), N-trideuteriumacetoxy, Acetyl:2H(3) |
H, N-term, K, S, T, Y |
UNIMOD:58 |
Propionyl |
56.026215 |
Propionate labeling reagent light form (N-term & K), Propionyl_light |
N-term, K, T, S |
UNIMOD:59 |
Propionyl_heavy |
59.036279 |
Propionate labeling reagent heavy form (+3amu), N-term & K, Propionyl:13C(3) |
N-term, K |
UNIMOD:60 |
Quat_0 |
127.099714 |
Quaternary amine labeling reagent light form (N-term & K), N-(4-trimethylammoniumbutanoxy)-NHS, GIST-Quat |
N-term, K |
UNIMOD:61 |
Quat_3 |
130.118544 |
GIST-Quat:2H(3), Quaternary amine labeling reagent heavy (+3amu) form, N-term & K |
N-term, K |
UNIMOD:62 |
Quat_6 |
133.137375 |
GIST-Quat:2H(6), Quaternary amine labeling reagent heavy form (+6amu), N-term & K |
N-term, K |
UNIMOD:63 |
Quat_9 |
136.156205 |
GIST-Quat:2H(9), Quaternary amine labeling reagent heavy form (+9amu), N-term & K |
N-term, K |
UNIMOD:64 |
Succinyl |
100.016044 |
Succinic anhydride labeling reagent light form (N-term & K), Suc_anh_light |
N-term, K |
UNIMOD:65 |
Suc_anh+4H2 |
104.041151 |
Succinyl:2H(4), Succinic anhydride labeling reagent, heavy form (+4amu, 4H2), N-term & K |
N-term, K |
UNIMOD:66 |
Suc_anh+4C13 |
104.029463 |
Succinyl:13C(4), Succinic anhydride labeling reagent, heavy form (+4amu, 4C13), N-term & K |
N-term, K |
UNIMOD:89 |
Im_biotin |
225.093583 |
Iminobiotin, Iminobiotinylation |
N-term, K |
UNIMOD:90 |
ESP |
338.177647 |
ESP-Tag light d0, ESP-Tag_light |
N-term, K |
UNIMOD:91 |
ESP:2H(10) |
348.240414 |
ESP-Tag heavy d10, ESP-Tag_heavy |
N-term, K |
UNIMOD:92 |
Biot_LC |
339.161662 |
N-biotinyl-6-aminohexanoyl, NHS-LC-Biotin |
N-term, K |
UNIMOD:93 |
EDT-m-biotin |
601.206246 |
EDT-maleimide-PEO-biotin |
S, T |
UNIMOD:94 |
IMID |
68.037448 |
Lys imidazole, IMID_light, 2-methoxy-4,5-dihydro-1H-imidazole derivative, IMID d0 |
K |
UNIMOD:95 |
IMID d4 |
72.062555 |
IMID:2H(4), IMID_heavy, 2-methoxy-4,5-dihydro-1H-imidazole derivative |
K |
UNIMOD:97 |
Acrylamide d3 |
74.055944 |
Propionamide:2H(3), Acrylamide_heavy |
C |
UNIMOD:105 |
ICAT-C |
227.126991 |
Applied Biosystems cleavable ICAT(TM) light, ICAT_light |
C |
UNIMOD:106 |
ICAT_heavy |
236.157185 |
ICAT-C:13C(9), Applied Biosystems cleavable ICAT(TM) heavy |
C |
UNIMOD:107 |
FormylMet |
159.035399 |
Addition of N-formyl met, +N-formyl-met |
N-term |
UNIMOD:108 |
NEM |
125.047679 |
N-ethylmaleimide on cysteines, CysNEM, Nethylmaleimide |
C |
UNIMOD:112 |
OxLysBiotinRed |
354.172562 |
Oxidized lysine biotinylated with biotin-LC-hydrazide, reduced |
K |
UNIMOD:113 |
OxLysBiotin |
352.156911 |
Oxidized lysine biotinylated with biotin-LC-hydrazide |
K |
UNIMOD:114 |
OxProBiotinRed |
371.199111 |
Oxidized proline biotinylated with biotin-LC-hydrazide, reduced |
P |
UNIMOD:115 |
OxProBiotin |
369.183461 |
Oxidized Proline biotinylated with biotin-LC-hydrazide |
P |
UNIMOD:116 |
OxArgBiotin |
310.135113 |
Oxidized arginine biotinylated with biotin-LC-hydrazide |
R |
UNIMOD:117 |
OxArgBiotinRed |
312.150763 |
Oxidized arginine biotinylated with biotin-LC-hydrazide, reduced |
R |
UNIMOD:118 |
EDT-i-biotin |
490.174218 |
EDT-iodo-PEO-biotin, EDT-iodoacetyl-PEO-biotin |
S, T |
UNIMOD:119 |
IBTP |
316.138088 |
Thio Ether Formation - BTP Adduct |
C |
UNIMOD:121 |
GG |
114.042927 |
GlyGly, ubiquitinylation residue, glycineglycine |
C, N-term, K, S, T |
UNIMOD:122 |
Formyl |
27.994915 |
Formylation |
N-term, K, T, S |
UNIMOD:123 |
ICAT-H |
345.097915 |
Harbury_ICAT_C12, N-iodoacetyl, p-chlorobenzyl-12C6-glucamine, Harbury glyco-ICAT C12 |
C |
UNIMOD:124 |
ICAT-H:13C(6) |
351.118044 |
Harbury_ICAT_C13, N-iodoacetyl, p-chlorobenzyl-13C6-glucamine, Harbury glyco-ICAT C13 |
C |
UNIMOD:126 |
DSP |
87.998285 |
Cleaved and reduced DSP/DTSSP crosslinker, (Was Thioacyl), Xlink:DTSSP[88] |
N-term, K |
UNIMOD:127 |
Fphe |
17.990578 |
fluorination, Fluoro |
W, F, Y, A |
UNIMOD:128 |
Fluorescein |
387.074287 |
5-Iodoacetamidofluorescein (Molecular Probe, Eugene, OR) |
C |
UNIMOD:129 |
Iodo |
125.896648 |
Iodination |
Y, H |
UNIMOD:130 |
Diiodo |
251.793296 |
di-Iodination |
Y, H |
UNIMOD:131 |
Triiodo |
377.689944 |
tri-Iodination |
Y |
UNIMOD:134 |
Myristoleyl |
208.182715 |
C14:1 acylation, myristoleylation, myristoyl with one double bond, (cis-delta 5)-tetradecaenoyl |
G @ Protein N-term |
UNIMOD:135 |
myristoyl-4H |
206.167065 |
myristoyl with 2 double bonds, (cis,cis-delta 5, delta 8)-tetradecadienoyl, Myristoyl+Delta:H(-4), C14:2 fatty acylation |
G @ Protein N-term |
UNIMOD:136 |
Benzoyl |
104.026215 |
labeling reagent light form (N-term & K), benzoyl |
N-term, K |
UNIMOD:137 |
M5/Man5 |
1216.422863 |
N-glycan, N-linked glycan core, Hex(5)HexNAc(2) |
N |
UNIMOD:139 |
dansyl |
233.051049 |
Dansyl, 5-dimethylaminonaphthalene-1-sulfonyl |
N-term, K |
UNIMOD:140 |
a-type-ion |
-46.005479 |
Decarboxylation of C-terminus as reaction inside the mass spectrometer, ISD a-series (C-Term), a-type_Ion |
C-term |
UNIMOD:141 |
amidine |
41.026549 |
N-terminal amines with methyl acetimidate, Amidine, amidination of lysines or N-terminal amines with methyl acetimidate, amidination of lysines |
N-term, K |
UNIMOD:142 |
HexNAc1dHex1 |
349.137281 |
HexNAc(1)dHex(1) |
S, N, T |
UNIMOD:143 |
HexNAc2 |
406.158745 |
HexNAc(2) |
S, N, T |
UNIMOD:144 |
Hex3 |
486.158471 |
Hex(3) |
S, N, T |
UNIMOD:145 |
HexNAc1dHex2 |
495.19519 |
HexNAc(1)dHex(2) |
N |
UNIMOD:146 |
Hex1HexNAc1dHex1 |
511.190105 |
Hex(1)HexNAc(1)dHex(1) |
S, N, T |
UNIMOD:147 |
HexNAc2dHex1 |
552.216654 |
HexNAc(2)dHex(1) |
N |
UNIMOD:148 |
Hex1HexNAc2 |
568.211569 |
Hex(1)HexNAc(2) |
S, N, T |
UNIMOD:149 |
Hex1HexNAc1NeuAc1 |
656.227613 |
Hex(1)HexNAc(1)NeuAc(1) |
S, N, T |
UNIMOD:150 |
HexNAc2dHex2 |
698.274563 |
HexNAc(2)dHex(2) |
N |
UNIMOD:151 |
Hex1HexNAc2Pent1 |
700.253828 |
Hex(1)HexNAc(2)Pent(1) |
N |
UNIMOD:152 |
Hex1HexNAc2dHex1 |
714.269478 |
Hex(1)HexNAc(2)dHex(1) |
S, N, T |
UNIMOD:153 |
Hex2HexNAc2 |
730.264392 |
Hex(2)HexNAc(2) |
S, N, T |
UNIMOD:154 |
Hex3HexNAc1Pent1 |
821.280102 |
Hex(3)HexNAc(1)Pent(1) |
N |
UNIMOD:155 |
Hex1HexNAc2dHex1Pent1 |
846.311736 |
Hex(1)HexNAc(2)dHex(1)Pent(1) |
N |
UNIMOD:156 |
Hex1HexNAc2dHex2 |
860.327386 |
Hex(1)HexNAc(2)dHex(2) |
S, N, T |
UNIMOD:157 |
Hex2HexNAc2Pent1 |
862.306651 |
Hex(2)HexNAc(2)Pent(1) |
N |
UNIMOD:158 |
Hex2HexNAc2dHex1 |
876.322301 |
Hex(2)HexNAc(2)dHex(1) |
S, N, T |
UNIMOD:159 |
M3/Man3 |
892.317216 |
Hex(3)HexNAc(2), chitobiose core, Hex3HexNAc2 |
S, N, T |
UNIMOD:160 |
Hex1HexNAc1NeuAc2 |
947.323029 |
Hex HexNAc NeuAc(2) —OR— Hex HexNAc(3) HexA, Hex(1)HexNAc(1)NeuAc(2) |
S, N, T |
UNIMOD:161 |
Hex3HexNAc2Phos1 |
972.283547 |
Hex(3) HexNAc(2) Phos, Hex(3)HexNAc(2)Phos(1) |
N |
UNIMOD:162 |
SeMet |
47.944449 |
Delta:S(-1)Se(1), Selenium replaces sulfur |
M, C |
UNIMOD:170 |
GN18Olabeling |
2.988261 |
Delta:H(-1)N(-1)18O(1), glycosylated asparagine 18O labeling |
N |
UNIMOD:171 |
NBS-13C |
159.008578 |
Shimadzu NBS-13C, NBS:13C(6), NBS reagent heavy |
W |
UNIMOD:172 |
NBS |
152.988449 |
NBS-12C, Shimadzu NBS-12C, 2-nitrobenzenesulfenyl |
W |
UNIMOD:176 |
BHT |
218.167065 |
Michael addition of BHT quinone methide to Cysteine and Lysine, Butylated Hydroxytoluene |
K, H, C |
UNIMOD:178 |
DAET |
87.050655 |
phosphorylation to amine thiol, b-elimination thiol derivatization, ser_thr_DAET |
S, T |
UNIMOD:184 |
13C9 |
9.030193 |
Label:13C(9), 13C(9) Silac label, heavy tyrosine |
F, Y |
UNIMOD:185 |
13C9_Phospho_Tyr |
88.996524 |
C13 label (Phosphotyrosine), heavy phosphotyrosine, Label:13C(9)+Phospho |
Y |
UNIMOD:186 |
HPG |
132.021129 |
Hydroxyphenylglyoxal arginine, HPG arginine, Arg1HPG |
R |
UNIMOD:187 |
2HPG |
282.052824 |
Arg2HPG, bis(hydroxphenylglyoxal) arginine |
R |
UNIMOD:188 |
13C6 |
6.020129 |
Label:13C(6), 13C(6) Silac label |
I, K, R, L |
UNIMOD:193 |
double_O18 |
4.008491 |
Double O18 (C-term), Label:18O(2), O18 label at both C-terminal oxygens |
C-term |
UNIMOD:194 |
AccQTag |
170.048013 |
6-aminoquinolyl-N-hydroxysuccinimidyl carbamate |
N-term, K |
UNIMOD:195 |
QAT |
171.149738 |
(3-acrylamidopropyl)trimethylammonium, APTA-d0 |
C |
UNIMOD:196 |
QATd3 |
174.168569 |
(3-acrylamidopropyl)trimethylammonium, QAT:2H(3), APTA d3 |
C |
UNIMOD:197 |
EQAT |
184.157563 |
EAPTA d0 |
C |
UNIMOD:198 |
EQATd5 |
189.188947 |
EAPTA d5, EQAT:2H(5) |
C |
UNIMOD:199 |
CHD2 |
32.056407 |
reductive amination, DiMethyl-CHD2, Dimethyl:2H(4) |
N-term, K, R |
UNIMOD:200 |
EDT |
75.980527 |
Ethanedithiol |
S, T |
UNIMOD:205 |
Acrolein94 |
94.041865 |
Delta:H(6)C(6)O(1), Acrolein94, FDP, Acrolein addition +94 |
K |
UNIMOD:206 |
Acrolein56 |
56.026215 |
Acrolein addition +56, Delta:H(4)C(3)O(1) |
K, R, H, C |
UNIMOD:207 |
Acrolein38 |
38.01565 |
Delta:H(2)C(3), Acrolein addition +38 |
K |
UNIMOD:208 |
Acrolein76 |
76.0313 |
Delta:H(4)C(6), Acrolein addition +76 |
K |
UNIMOD:209 |
Acrolein112 |
112.05243 |
Acrolein addition +112, Delta:H(8)C(6)O(2) |
K |
UNIMOD:211 |
NEIAA |
85.052764 |
N-ethyl iodoacetamide-d0, NEIAA-d0 |
Y, C |
UNIMOD:212 |
NEIAA-d5 |
90.084148 |
N-ethyl iodoacetamide-d5, NEIAA:2H(5) |
Y, C |
UNIMOD:213 |
ADP-Ribose |
541.06111 |
ADP-Ribosyl, ADP Ribose addition |
C, N, K, S, D, T, R, E |
UNIMOD:214 |
iTRAQ |
144.102063 |
Representative mass and accurate mass for 116 & 117, iTRAQ4plex, Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry, AKA iTRAQ4plex116/7 |
H, C, N-term, K, S, T, Y |
UNIMOD:243 |
IGBP |
296.016039 |
Light IDBEST tag for quantitation |
C |
UNIMOD:253 |
Croton |
70.041865 |
Crotonaldehyde |
K, H, C |
UNIMOD:254 |
Acetald+26 |
26.01565 |
Delta:H(2)C(2), Acetaldehyde +26 |
N-term, K, H |
UNIMOD:255 |
Acetald+28 |
28.0313 |
Delta:H(4)C(2), Acetaldehyde +28 |
N-term, K, H |
UNIMOD:256 |
Propionald+40 |
40.0313 |
Propionaldehyde +40, Delta:H(4)C(3) |
N-term, K, H |
UNIMOD:258 |
O18_STY |
2.004246 |
H2 18O Alkaline Phosphatase, Label:18O(1), O18 Labeling |
S, Y, T, C-term |
UNIMOD:259 |
13C6-15N2 |
8.014199 |
heavy lysine, Label:13C(6)15N(2), 13C(6) 15N(2) Silac label |
K |
UNIMOD:260 |
Thiophospho |
95.943487 |
Thiophosphorylation, Thio-phospho |
S, Y, T |
UNIMOD:261 |
SPITC |
214.971084 |
4-sulfophenyl isothiocyanate, N-terminal / lysine sulfonation |
N-term, K |
UNIMOD:262 |
D3_Label |
3.01883 |
Trideuteration, Label:2H(3) |
M, L |
UNIMOD:264 |
PET |
121.035005 |
phosphorylation to pyridyl thiol, b-elimination PET derivatisation |
S, T |
UNIMOD:267 |
13C6-15N4 |
10.008269 |
13C(6) 15N(4) Silac label, Label:13C(6)15N(4) |
R |
UNIMOD:268 |
13C5-15N1 |
6.013809 |
13C(5) 15N(1) Silac label, Label:13C(5)15N(1) |
V, M, E, P |
UNIMOD:269 |
13C9-15N1 |
10.027228 |
13C(9) 15N(1) Silac label, Label:13C(9)15N(1) |
F |
UNIMOD:270 |
Cytopiloyne |
362.136553 |
nucleophilic addtion to cytopiloyne, cytopiloyne |
C, N-term, K, P, S, R, Y |
UNIMOD:271 |
cytopiloyne+H2O |
380.147118 |
Cytopiloyne+water, nucleophilic addition to cytopiloyne+H2O |
C, N-term, K, S, T, R, Y |
UNIMOD:272 |
CAF |
135.983029 |
Ettan CAF MALDI, sulfonation of N-terminus |
N-term |
UNIMOD:275 |
SNO |
28.990164 |
Nitrosyl, nitrosylation |
Y, C |
UNIMOD:276 |
AEBS |
183.035399 |
Aminoethylbenzenesulfonylation |
H, N-term, K, S, Y |
UNIMOD:278 |
EtOH |
44.026215 |
Ethanolyl, Ethanolation, Hydroxy ethyl |
K, R, C |
UNIMOD:280 |
Ethyl |
28.0313 |
Ethylation |
N-term, C-term, K, D, E |
UNIMOD:281 |
CysCoA |
765.09956 |
CoenzymeA, Cysteine modified Coenzyme A |
C |
UNIMOD:284 |
DeMet |
16.028204 |
Deuterium Methylation of Lysine, Methyl:2H(2) |
N-term, K |
UNIMOD:285 |
SA_light |
155.004099 |
C-Terminal/Glutamate/Aspartate sulfonation, Light Sulfanilic Acid (SA) C12, SulfanilicAcid |
C-term, D, E |
UNIMOD:286 |
SA_heavy |
161.024228 |
C-Terminal/Glutamate/Aspartate sulfonation, SulfanilicAcid:13C(6), Heavy Sulfanilic Acid (SA) C13 |
C-term, D, E |
UNIMOD:288 |
oxolactone |
13.979265 |
Tryptophan oxidation to oxolactone, Trp->Oxolactone |
W |
UNIMOD:289 |
BiotinPEO-amine |
356.188212 |
Biotin-PEO-Amine, Biotin polyethyleneoxide amine |
C-term, D, E |
UNIMOD:290 |
Biotin-HPDP |
428.191582 |
Biotin:Thermo-21341, Pierce EZ-Link Biotin-HPDP |
C |
UNIMOD:291 |
Hg |
201.970617 |
Mercury Mercaptan, Delta:Hg(1) |
C |
UNIMOD:292 |
IodoU-AMP |
322.020217 |
(Iodo)-uracil MP, UV induced linkage of Iodo-U-amp with WFY |
W, F, Y |
UNIMOD:293 |
CAMthiopropanoyl |
145.019749 |
3-thiopropanoyl moiety from reduced DSP crosslinker, 3-thiopropanoyl moiety from reduced DSP crosslinker or NHS-SS-biotin, modified with Iodoacetamide, NHS-SS-biotin, modified with Iodoacetamide, 3-(carbamidomethylthio)propanoyl |
N-term, K |
UNIMOD:294 |
ied-biotin |
326.141261 |
biotinoyl-iodoacetyl-ethylenediamine, IED-Biotin |
C |
UNIMOD:295 |
Fuc |
146.057909 |
deoxyhexose, dHex, Fucose |
S, N, T |
UNIMOD:298 |
D3-Me-ester |
17.03448 |
Methyl:2H(3), deuterated methyl ester |
, K, D, R, E |
UNIMOD:299 |
Carboxy |
43.989829 |
Carboxylation, carboxyl |
M @ Protein N-term, K, W, D, E |
UNIMOD:301 |
Bromobimane |
190.074228 |
mBromobimane, Monobromobimane derivative |
C |
UNIMOD:302 |
Menadione |
170.036779 |
Menadione-Q, Vitamin k3 (Q), Menadione quinone derivative |
K, C |
UNIMOD:303 |
DeStreak |
75.998285 |
Cysteine mercaptoethanol |
C |
UNIMOD:305 |
G0F |
1444.53387 |
dHex(1)Hex(3)HexNAc(4), FA2/G0F |
S, N, T |
UNIMOD:307 |
G1F |
1606.586693 |
FA2G1/G1F, dHex(1)Hex(4)HexNAc(4), dHex Hex(4) HexNAc(4) —OR— Hex(4) HexNAc(4) Pent Me |
S, N, T |
UNIMOD:308 |
G2F |
1768.639517 |
FA2G2/G2F, dHex(1)Hex(5)HexNAc(4) |
N |
UNIMOD:309 |
G0 |
1298.475961 |
Hex(3)HexNAc(4), A2/G0 |
S, N, T |
UNIMOD:310 |
G1 |
1460.528784 |
A2G1/G1, Hex(4)HexNAc(4) |
S, N, T |
UNIMOD:311 |
G2 |
1622.581608 |
A2G2/G2, Hex(5)HexNAc(4) |
S, N, T |
UNIMOD:312 |
Cysteinyl |
119.004099 |
Cysteinylation |
C |
UNIMOD:313 |
-K |
-128.094963 |
Loss of Lysine, Lys-loss |
K @ Protein C-term, K |
UNIMOD:314 |
NMM |
111.032028 |
Nmethylmaleimide |
K, C |
UNIMOD:316 |
pyrrole |
78.04695 |
DimethylpyrroleAdduct, 2,5-dimethypyrrole |
K |
UNIMOD:318 |
MDA62 |
62.01565 |
MDA adduct +62, Delta:H(2)C(5) |
K |
UNIMOD:319 |
MDA54 |
54.010565 |
MDA adduct +54, Delta:H(2)C(3)O(1) |
K, R |
UNIMOD:320 |
NEMhyd |
143.058243 |
Nethylmaleimide+water, Nethylmaleimidehydrolysis |
K, C |
UNIMOD:323 |
bNis |
713.093079 |
Xlink:B10621, BSR monolink, bis-((N-iodoacetyl)piperazinyl)sulfonerhodamine |
C |
UNIMOD:324 |
DTBP |
87.01427 |
Cleaved and reduced DTBP crosslinker, Xlink:DTBP[87], dimethyl 3,3’-dithiobispropionimidate |
N-term, K |
UNIMOD:325 |
FP-Biotin |
572.316129 |
O-ethyl-N-(biotinamidopentyl)decanamido phosphonate, 10-ethoxyphosphinyl-N-(biotinamidopentyl)decanamide |
S, T, K, Y |
UNIMOD:327 |
S-Eth |
44.008456 |
Delta:H(4)C(2)O(-1)S(1), S-Ethylcystine from Serine |
S |
UNIMOD:329 |
Methyl-Heavy |
18.037835 |
Methyl:2H(3)13C(1), monomethylation |
N-term, K, R |
UNIMOD:330 |
dimethylation |
36.07567 |
Dimethyl:2H(6)13C(2), Dimethyl-Heavy |
N-term, K, R |
UNIMOD:332 |
Thiophos-S-S-biotin |
525.142894 |
thiophosphate labeled with biotin-HPDP, Thiophos-biotin disulfide |
S, Y, T |
UNIMOD:333 |
Can-FP-biotin |
447.195679 |
O-isopropyl-N-biotinylaminohexyl phosphonate, 6-N-biotinylaminohexyl isopropyl phosphate, Biotin:TRC-B394885 |
S, T, Y |
UNIMOD:335 |
redHNE |
158.13068 |
reduced 4-Hydroxynonenal, HNE+Delta:H(2) |
K, H, C |
UNIMOD:337 |
Methylamine |
13.031634 |
MethylamineST, Michael addition with methylamine |
S, T |
UNIMOD:340 |
bromo |
77.910511 |
Bromo, bromination |
W, F, Y, H |
UNIMOD:342 |
Amino |
15.010899 |
Tyrosine oxidation to 2-aminotyrosine, aminotyrosine |
Y |
UNIMOD:343 |
Argbiotinhydrazide |
199.066699 |
oxidized Arginine biotinylated with biotin hydrazide |
R |
UNIMOD:344 |
Arg->GluSA |
-43.053433 |
Arginine oxidation to glutamic semialdehyde, Arginine oxidation to gamma-glutamyl semialdehyde, Argglutamicsealde |
R |
UNIMOD:345 |
Cysteic_acid |
47.984744 |
Trioxidation, cysteine oxidation to cysteic acid |
W, F, Y, C |
UNIMOD:348 |
His2Asn |
-23.015984 |
His->Asn, His->Asn substitution, histidine oxidation to aspargine |
H |
UNIMOD:349 |
His2Asp |
-22.031969 |
His->Asp substitution, histidine oxidation to aspartic acid, His->Asp |
H |
UNIMOD:350 |
hydroxykynurenin |
19.989829 |
tryptophan oxidation to hydroxykynurenin, Trp->Hydroxykynurenin |
W |
UNIMOD:351 |
kynurenin |
3.994915 |
Trp->Kynurenin, tryptophan oxidation to kynurenin |
W |
UNIMOD:352 |
Lys->Allysine |
-1.031634 |
Lysaminoadipicsealde, Lysine oxidation to aminoadipic semialdehyde |
K |
UNIMOD:353 |
Lysbiotinhydrazide |
241.088497 |
oxidized Lysine biotinylated with biotin hydrazide |
K |
UNIMOD:354 |
Nitro |
44.985078 |
Oxidation to nitro |
W, F, Y |
UNIMOD:357 |
probiotinhydrazide |
258.115047 |
oxidized proline biotinylated with biotin hydrazide |
P |
UNIMOD:359 |
Pyroglutamic |
13.979265 |
proline oxidation to pyroglutamic acid, Pro->pyro-Glu |
P |
UNIMOD:360 |
Pyrrolidinone |
-30.010565 |
Proline oxidation to pyrrolidinone, Pro->Pyrrolidinone |
P |
UNIMOD:361 |
Thrbiotinhydrazide |
240.104482 |
oxidized Threonine biotinylated with biotin hydrazide |
T |
UNIMOD:362 |
Diisopropylphosphate |
164.060231 |
O-Diisopropylphosphate, O-Diisopropylphosphorylation |
N-term, K, S, T, Y |
UNIMOD:363 |
Isopropylphospho |
122.013281 |
O-Isopropylphosphorylation, O-Isopropylphosphate |
S, Y, T |
UNIMOD:364 |
ICPL_heavy |
111.041593 |
ICPL:13C(6), Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, heavy form |
N-term, K |
UNIMOD:365 |
ICPL |
105.021464 |
Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, light form, ICPL_light |
N-term, K |
UNIMOD:366 |
Deamidation_O18 |
2.988261 |
Deamidation in presence of O18, Deamidated:18O(1) |
N, Q |
UNIMOD:368 |
Cys->Dha |
-33.987721 |
DehydroalaC, Dehydroalanine (from Cysteine) |
C |
UNIMOD:369 |
OxPro |
-27.994915 |
Pyrrolidone from Proline, Pro->Pyrrolidone |
P |
UNIMOD:371 |
HMVK |
86.036779 |
hydroxymethylvinyl ketone, Michael addition of hydroxymethylvinyl ketone to cysteine, HMVK86 |
C |
UNIMOD:372 |
Arg2Orn |
-42.021798 |
Arg->Orn, Ornithine from Arginine |
R |
UNIMOD:374 |
Cystine |
-1.007825 |
Dehydro, Half of a disulfide bridge |
C |
UNIMOD:375 |
Diphthamide |
142.110613 |
H |
|
UNIMOD:376 |
Hydroxyfarnesyl |
220.182715 |
hydroxyfarnesyl |
C |
UNIMOD:377 |
Diacylglycerol |
576.511761 |
diacylglycerol |
C |
UNIMOD:378 |
Carboxyethyl |
72.021129 |
Ethoxyformylation, carboxyethyl |
K, H |
UNIMOD:379 |
hypusine |
87.068414 |
Hypusine |
K |
UNIMOD:380 |
retinal |
266.203451 |
Retinylidene |
K |
UNIMOD:381 |
aminoadipic |
14.96328 |
alpha-amino adipic acid, Lys->AminoadipicAcid |
K |
UNIMOD:382 |
pyruvicC |
-33.003705 |
pyruvic acid from N-term cys, Cys->PyruvicAcid |
C @ Protein N-term |
UNIMOD:385 |
Ammonia-loss |
-17.026549 |
Loss of ammonia, N-oxobutanoic, oxobutanoic acid from N term Thr, pyruvic acid from N-term ser |
S @ Protein N-term, N, T @ Protein N-term, C @ N-term |
UNIMOD:387 |
phycobiliviolin |
586.279135 |
Phycocyanobilin, phycocyanobilin |
C |
UNIMOD:388 |
phycoerythrobilin |
588.294785 |
Phycoerythrobilin |
C |
UNIMOD:389 |
Phytochromobilin |
584.263485 |
phytochromobilin |
C |
UNIMOD:390 |
Heme |
616.177295 |
heme |
H, C |
UNIMOD:391 |
Molybdopterin |
521.884073 |
molybdopterin |
C |
UNIMOD:392 |
quinone |
29.974179 |
Quinone |
W, Y |
UNIMOD:393 |
glucosylgalactosyl |
340.100562 |
glucosylgalactosyl hydroxylysine, Glucosylgalactosyl |
K |
UNIMOD:394 |
GPIanchor |
123.00853 |
GPI-anchor, glycosylphosphatidylinositol |
C-term |
UNIMOD:395 |
pRibodePcoA |
881.146904 |
PhosphoribosyldephosphoCoA, phosphoribosyl dephospho-coenzyme A |
S |
UNIMOD:396 |
GlycerylPE |
197.04531 |
glycerylPE, glycerylphosphorylethanolamine |
E |
UNIMOD:397 |
triiodo |
469.716159 |
Triiodothyronine |
Y |
UNIMOD:398 |
tetraiodo |
595.612807 |
Thyroxine |
Y |
UNIMOD:400 |
Tyr->Dha |
-94.041865 |
Dehydroalanine (from Tyrosine), DehydroalaY |
Y |
UNIMOD:401 |
didehydro |
-2.01565 |
2-amino-3-oxo-butanoic_acid, oxoalanine, Didehydro |
S, T, K @ C-term, Y |
UNIMOD:402 |
oxoalanine |
-17.992806 |
Cys->Oxoalanine, formylglycine |
C |
UNIMOD:403 |
lactic |
-15.010899 |
Ser->LacticAcid, lactic acid from N-term Ser |
S @ Protein N-term |
UNIMOD:405 |
AMP |
329.05252 |
p-adenosine, Phosphoadenosine |
H, K, S, T, Y |
UNIMOD:407 |
Hydroxycinnamyl |
146.036779 |
hydroxycinnamyl |
C |
UNIMOD:408 |
Glycosyl |
148.037173 |
glycosyl-L-hydroxyproline, glycosyl |
P |
UNIMOD:409 |
FMN |
454.088965 |
flavin mononucleotide, FMNH |
H, C |
UNIMOD:410 |
Archaeol |
634.662782 |
S-archaeol, S-diphytanylglycerol diether |
C |
UNIMOD:411 |
PIC |
119.037114 |
Phenylisocyanate, phenyl isocyanate |
N-term |
UNIMOD:412 |
d5-PIC |
124.068498 |
d5-phenyl isocyanate, Phenylisocyanate:2H(5) |
N-term |
UNIMOD:413 |
p-guanosine |
345.047435 |
Phosphoguanosine, phospho-guanosine |
K, H |
UNIMOD:414 |
hydroxymethyl |
30.010565 |
Hydroxymethyl |
N |
UNIMOD:415 |
molybdopterin-se |
1620.930224 |
MolybdopterinGD+Delta:S(-1)Se(1), L-selenocysteinyl molybdenum bis(molybdopterin guanine dinucleotide) |
C |
UNIMOD:416 |
dipyrrole |
418.137616 |
Dipyrrolylmethanemethyl, dipyrrolylmethanemethyl |
C |
UNIMOD:417 |
p-uridine |
306.025302 |
PhosphoUridine, uridine phosphodiester |
Y, H |
UNIMOD:419 |
glycerophospho |
154.00311 |
Glycerophospho |
S |
UNIMOD:420 |
thiocarboxy |
15.977156 |
Carboxy->Thiocarboxy, thiocarboxylic acid |
G @ Protein C-term |
UNIMOD:421 |
Sulfide |
31.972071 |
persulfide |
D, W, C |
UNIMOD:422 |
pyruv-iminyl |
70.005479 |
N-pyruvic acid 2-iminyl, PyruvicAcidIminyl |
V @ Protein N-term, K, C @ Protein N-term |
UNIMOD:423 |
selenyl |
79.91652 |
Delta:Se(1) |
C |
UNIMOD:424 |
MolybdopterinGD |
1572.985775 |
molybdopterin-gd, molybdenum bis(molybdopterin guanine dinucleotide) |
D, U, C |
UNIMOD:425 |
dihydroxy |
31.989829 |
Dioxidation |
C, M, V, K, U, P, F, W, R, E, I, Y, L |
UNIMOD:426 |
octanoyl |
126.104465 |
Octanoyl |
S, T, C |
UNIMOD:428 |
p-GlcNAc |
283.045704 |
N-acetylglucosamine-1-phosphoryl, PhosphoHexNAc |
S, T |
UNIMOD:429 |
p-Man |
242.019154 |
phosphoglycosyl-D-mannose-1-phosphoryl, PhosphoHex |
S, T |
UNIMOD:431 |
palmitoleyl |
236.214016 |
Palmitoleyl |
S, T, C |
UNIMOD:432 |
Cholesterol |
368.344302 |
cholesterol ester, C-cholesterol |
C-term |
UNIMOD:433 |
didehydroretinyl |
264.187801 |
Didehydroretinylidene, 3,4-didehydroretinylidene |
K |
UNIMOD:434 |
CHDH |
294.183109 |
cis-14-hydroxy-10,13-dioxo-7-heptadecenoic ester, LTP1-lipid |
D |
UNIMOD:435 |
me-pyrroline |
109.052764 |
4-methyl-delta-1-pyrroline-5-carboxyl, Methylpyrroline |
K |
UNIMOD:436 |
hydroxyheme |
614.161645 |
Hydroxyheme |
E |
UNIMOD:437 |
MicrocinC7 |
386.110369 |
(3-aminopropyl)(L-aspartyl-1-amino)phosphoryl-5-adenosine, C-Asn-deriv |
C-term |
UNIMOD:438 |
cyano |
24.995249 |
Cyano |
C |
UNIMOD:439 |
Fe-cluster |
342.786916 |
hydrogenase diiron subcluster, Diironsubcluster |
C |
UNIMOD:440 |
amidino |
42.021798 |
Amidino |
C |
UNIMOD:443 |
FMNC |
456.104615 |
FMN3, S-(4a-FMN) |
C |
UNIMOD:444 |
CuSMo |
922.834855 |
copper sulfido molybdopterin cytosine dinuncleotide |
C |
UNIMOD:445 |
trimethyl-OH |
59.04969 |
Hydroxytrimethyl, 5-hydroxy-N6,N6,N6-trimethyl |
K |
UNIMOD:447 |
Deoxy |
-15.994915 |
Threonine to a-aminobutyrate, reduction, Serine to Alanine, semialdehyde |
D, S, T |
UNIMOD:448 |
Microcin |
831.197041 |
microcin, microcin E492 siderophore ester from serine |
C-term |
UNIMOD:449 |
lipid |
154.135765 |
decanoyl, Decanoyl |
S, T |
UNIMOD:450 |
Glu |
129.042593 |
-Glu-, monoglutamyl |
C-term, E |
UNIMOD:451 |
GluGlu |
258.085186 |
-Glu-Glu-, diglutamyl |
C-term, E |
UNIMOD:452 |
GluGluGlu |
387.127779 |
triglutamyl, -Glu-Glu-Glu- |
C-term, E |
UNIMOD:453 |
GluGluGluGlu |
516.170373 |
-Glu-Glu-Glu-Glu-, tetraglutamyl |
C-term, E |
UNIMOD:454 |
HexN |
161.068808 |
Hexosamine, Galactosamine, Glucosamine |
N, K, S, W, T |
UNIMOD:455 |
DMP-s |
154.110613 |
Dimethyl pimelimidate, Xlink:DMP[154], Free monolink of DMP crosslinker |
N-term, K |
UNIMOD:456 |
Xlink:DMP |
122.084398 |
Dimethyl pimelimidate crosslink |
N-term, K |
UNIMOD:457 |
NDA |
175.042199 |
naphthalene-2,3-dicarboxaldehyde |
N-term, K |
UNIMOD:464 |
SPITC_Heavy |
220.991213 |
4-sulfophenyl isothiocyanate (Heavy C13), SPITC:13C(6), N-terminal / lysine sulfonation |
N-term, K |
UNIMOD:472 |
AEC-MAEC |
59.019355 |
aminoethylcysteine, beta-methylaminoethylcysteine |
S, T |
UNIMOD:476 |
TMAB |
128.107539 |
TMAB-d0, 4-trimethyllammoniumbutyryl- |
N-term, K |
UNIMOD:477 |
TMAB-d9 |
137.16403 |
TMAB:2H(9), d9-4-trimethyllammoniumbutyryl- |
N-term, K |
UNIMOD:478 |
FTC |
421.073241 |
fluorescein-5-thiosemicarbazide |
C, K, P, S, R |
UNIMOD:481 |
Lys4 |
4.025107 |
4,4,5,5-D4 Lysine, Label:2H(4), Alanine-2,3,3,3-d4 |
K, U, A, F, Y |
UNIMOD:488 |
DHP |
118.065674 |
Dehydropyrrolizidine alkaloid (dehydroretronecine) on cysteines, Dehydroretronecine |
C |
UNIMOD:490 |
Hep |
192.063388 |
Heptose |
N, K, S, T, R, Q |
UNIMOD:493 |
BADGE |
340.167459 |
Bisphenol A diglycidyl ether derivative |
C |
UNIMOD:494 |
CyDye-Cy3 |
672.298156 |
Formula needs confirmation, Cy3 CyDye DIGE Fluor saturation dye |
C |
UNIMOD:495 |
CyDye-Cy5 |
684.298156 |
Cy5 CyDye DIGE Fluor saturation dye |
C |
UNIMOD:498 |
K |
234.16198 |
BHTOH, Michael addition of t-butyl hydroxylated BHT (BHTOH) to C, H, t-butyl hydroxylated BHT, Michael addition of t-butyl hydroxylated BHT (BHTOH) to C, H or K |
, H, C |
UNIMOD:499 |
IGBP:13C(2) |
298.022748 |
Heavy IDBEST tag for quantitation |
C |
UNIMOD:500 |
NMMhyd |
129.042593 |
Nmethylmaleimidehydrolysis, Nmethylmaleimide+water |
C |
UNIMOD:501 |
PyMIC |
134.048013 |
3-methyl-2-pyridyl isocyanate |
N-term |
UNIMOD:503 |
LG-lactam-K |
332.19876 |
Levuglandinyl - lysine lactam adduct |
N-term, K |
UNIMOD:504 |
LG-Hlactam-K |
348.193674 |
Levuglandinyl - lysine hydroxylactam adduct |
N-term, K |
UNIMOD:505 |
LG-lactam-R |
290.176961 |
Levuglandinyl - arginine lactam adduct |
R |
UNIMOD:506 |
LG-Hlactam-R |
306.171876 |
Levuglandinyl - arginine hydroxylactam adduct |
R |
UNIMOD:510 |
C13HD2 |
34.063117 |
Dimethyl:2H(4)13C(2), DiMethyl-C13HD2 |
N-term, K, R |
UNIMOD:512 |
lac |
324.105647 |
Hex(2), Gal-Glu, Lactosylation |
S, K, T, R |
UNIMOD:513 |
C8-QAT |
227.224915 |
[3-(2,5)-Dioxopyrrolidin-1-yloxycarbonyl)-propyl]dimethyloctylammonium |
N-term, K |
UNIMOD:514 |
PropylNAGthiazoline |
232.064354 |
propyl-NAG-thiazoline, propyl-1,2-dideoxy-2'-methyl-alpha-D-glucopyranoso-[2,1-d]-Delta2'-thiazoline |
C |
UNIMOD:515 |
FNEM |
427.069202 |
F-NEM, fluorescein-5-maleimide, fluorescein-NEM |
C |
UNIMOD:518 |
Diethyl |
56.0626 |
Diethylation, analogous to Dimethylation, Diethylation |
N-term, K |
UNIMOD:519 |
BisANS |
594.091928 |
4,4'-dianilino-1,1'-binaphthyl-5,5'-disulfonic acid |
K |
UNIMOD:520 |
Piperidine |
68.0626 |
Piperidination |
N-term, K |
UNIMOD:522 |
Maleimide-Biotin |
525.225719 |
Maleimide-PEO2-Biotin, Maleimide-PEG2-Biotin, Biotin:Thermo-21901 |
C |
UNIMOD:523 |
Biot_LC_LC |
452.245726 |
Biotin:Thermo-21338, Sulfo-NHS-LC-LC-Biotin |
N-term, K |
UNIMOD:525 |
CLIP_TRAQ_2 |
141.098318 |
CLIP_TRAQ_double |
N-term, K, Y |
UNIMOD:526 |
Dethiomethyl |
-48.003371 |
Prompt loss of side chain from oxidised Met |
M |
UNIMOD:528 |
Methyl+Deamidated |
14.999666 |
Deamidation followed by a methylation, Glutamate methyl ester |
Q, N |
UNIMOD:529 |
Delta:H(5)C(2) |
29.039125 |
Dimethylation of proline residue |
P |
UNIMOD:530 |
Cation:K |
37.955882 |
Replacement of proton by potassium |
D, C-term, E |
UNIMOD:531 |
Cation:Cu |
61.921774 |
Cation:Cu[I], Replacement of proton by copper |
D, C-term, E, H |
UNIMOD:532 |
iTRAQ114 |
144.105918 |
Accurate mass for 114, Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry, iTRAQ4plex114 |
N-term, K, Y, C |
UNIMOD:533 |
iTRAQ115 |
144.099599 |
iTRAQ4plex115, Accurate mass for 115, Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry |
N-term, K, Y, C |
UNIMOD:534 |
Dibromo |
155.821022 |
Y |
|
UNIMOD:535 |
LRGG |
383.228103 |
LeuArgGlyGly, Addition of LRGG, Ubiquitination |
K |
UNIMOD:536 |
CLIP_TRAQ_3 |
271.148736 |
N-term, K, Y |
|
UNIMOD:537 |
CLIP_TRAQ_4 |
244.101452 |
N-term, K, Y |
|
UNIMOD:538 |
was 15dB-biotin |
626.386577 |
15-deoxy-delta 12,14-Prostaglandin J2-biotinimide, Biotin:Cayman-10141 |
C |
UNIMOD:539 |
was PGA1-biotin |
660.428442 |
Biotin:Cayman-10013, Prostaglandin A1-biotinimide |
C |
UNIMOD:540 |
Ala->Ser |
15.994915 |
Ala->Ser substitution |
A |
UNIMOD:541 |
Ala->Thr |
30.010565 |
Ala->Thr substitution |
A |
UNIMOD:542 |
Ala->Asp |
43.989829 |
Ala->Asp substitution |
A |
UNIMOD:543 |
Ala->Pro |
26.01565 |
Ala->Pro substitution |
A |
UNIMOD:544 |
Ala->Gly |
-14.01565 |
Ala->Gly substitution |
A |
UNIMOD:545 |
Ala->Glu |
58.005479 |
Ala->Glu substitution |
A |
UNIMOD:546 |
Ala->Val |
28.0313 |
Ala->Val substitution |
A |
UNIMOD:547 |
Cys->Phe |
44.059229 |
Cys->Phe substitution |
C |
UNIMOD:548 |
Cys->Ser |
-15.977156 |
Cys->Ser substitution |
C |
UNIMOD:549 |
Cys->Trp |
83.070128 |
Cys->Trp substitution |
C |
UNIMOD:550 |
Cys->Tyr |
60.054144 |
Cys->Tyr substitution |
C |
UNIMOD:551 |
Cys->Arg |
53.091927 |
Cys->Arg substitution |
C |
UNIMOD:552 |
Cys->Gly |
-45.987721 |
Cys->Gly substitution |
C |
UNIMOD:553 |
Asp->Ala |
-43.989829 |
Asp->Ala substitution |
D |
UNIMOD:554 |
Asp->His |
22.031969 |
Asp->His substitution |
D |
UNIMOD:555 |
Asp->Asn |
-0.984016 |
Asp->Asn substitution |
D |
UNIMOD:556 |
Asp->Gly |
-58.005479 |
Asp->Gly substitution |
D |
UNIMOD:557 |
Asp->Tyr |
48.036386 |
Asp->Tyr substitution |
D |
UNIMOD:558 |
Asp->Glu |
14.01565 |
Asp->Glu substitution |
D |
UNIMOD:559 |
Asp->Val |
-15.958529 |
Asp->Val substitution |
D |
UNIMOD:560 |
Glu->Ala |
-58.005479 |
Glu->Ala substitution |
E |
UNIMOD:561 |
Glu->Gln |
-0.984016 |
Glu->Gln substitution |
E |
UNIMOD:562 |
Glu->Asp |
-14.01565 |
Glu->Asp substitution |
E |
UNIMOD:563 |
Glu->Lys |
-0.94763 |
Glu->Lys substitution |
E |
UNIMOD:564 |
Glu->Gly |
-72.021129 |
Glu->Gly substitution |
E |
UNIMOD:565 |
Glu->Val |
-29.974179 |
Glu->Val substitution |
E |
UNIMOD:566 |
Phe->Ser |
-60.036386 |
Phe->Ser substitution |
F |
UNIMOD:567 |
Phe->Cys |
-44.059229 |
Phe->Cys substitution |
F |
UNIMOD:568 |
Phe->Xle |
-33.98435 |
Phe->Leu/Ile substitution |
F |
UNIMOD:569 |
Phe->Tyr |
15.994915 |
Phe->Tyr substitution |
F |
UNIMOD:570 |
Phe->Val |
-48.0 |
Phe->Val substitution |
F |
UNIMOD:571 |
Gly->Ala |
14.01565 |
Gly->Ala substitution |
G |
UNIMOD:572 |
Gly->Ser |
30.010565 |
Gly->Ser substitution |
G |
UNIMOD:573 |
Gly->Trp |
129.057849 |
Gly->Trp substitution |
G |
UNIMOD:574 |
Gly->Glu |
72.021129 |
Gly->Glu substitution |
G |
UNIMOD:575 |
Gly->Val |
42.04695 |
Gly->Val substitution |
G |
UNIMOD:576 |
Gly->Asp |
58.005479 |
Gly->Asp substitution |
G |
UNIMOD:577 |
Gly->Cys |
45.987721 |
Gly->Cys substitution |
G |
UNIMOD:578 |
Gly->Arg |
99.079647 |
Gly->Arg substitution |
G |
UNIMOD:580 |
His->Pro |
-40.006148 |
His->Pro substitution |
H |
UNIMOD:581 |
His->Tyr |
26.004417 |
His->Tyr substitution |
H |
UNIMOD:582 |
His->Gln |
-9.000334 |
His->Gln substitution |
H |
UNIMOD:584 |
His->Arg |
19.042199 |
His->Arg substitution |
H |
UNIMOD:585 |
His->Xle |
-23.974848 |
His->Leu/Ile substitution |
H |
UNIMOD:588 |
Xle->Thr |
-12.036386 |
Leu/Ile->Thr substitution |
I, L |
UNIMOD:589 |
Xle->Asn |
0.958863 |
Leu/Ile->Asn substitution |
I, L |
UNIMOD:590 |
Xle->Lys |
15.010899 |
Leu/Ile->Lys substitution |
I, L |
UNIMOD:594 |
Lys->Thr |
-27.047285 |
Lys->Thr substitution |
K |
UNIMOD:595 |
Lys->Asn |
-14.052036 |
Lys->Asn substitution |
K |
UNIMOD:596 |
Lys->Glu |
0.94763 |
Lys->Glu substitution |
K |
UNIMOD:597 |
Lys->Gln |
-0.036386 |
Lys->Gln substitution |
K |
UNIMOD:598 |
Lys->Met |
2.945522 |
Lys->Met substitution |
K |
UNIMOD:599 |
Lys->Arg |
28.006148 |
Lys->Arg substitution |
K |
UNIMOD:600 |
Lys->Xle |
-15.010899 |
Lys->Leu/Ile substitution |
K |
UNIMOD:601 |
Xle->Ser |
-26.052036 |
Leu/Ile->Ser substitution |
I, L |
UNIMOD:602 |
Xle->Phe |
33.98435 |
Leu/Ile->Phe substitution |
I, L |
UNIMOD:603 |
Xle->Trp |
72.995249 |
Leu/Ile->Trp substitution |
I, L |
UNIMOD:604 |
Xle->Pro |
-16.0313 |
Leu/Ile->Pro substitution |
I, L |
UNIMOD:605 |
Xle->Val |
-14.01565 |
Leu/Ile->Val substitution |
I, L |
UNIMOD:606 |
Xle->His |
23.974848 |
Leu/Ile->His substitution |
I, L |
UNIMOD:607 |
Xle->Gln |
14.974514 |
Leu/Ile->Gln substitution |
I, L |
UNIMOD:608 |
Xle->Met |
17.956421 |
Leu/Ile->Met substitution |
I, L |
UNIMOD:609 |
Xle->Arg |
43.017047 |
Leu/Ile->Arg substitution |
I, L |
UNIMOD:610 |
Met->Thr |
-29.992806 |
Met->Thr substitution |
M |
UNIMOD:611 |
Met->Arg |
25.060626 |
Met->Arg substitution |
M |
UNIMOD:613 |
Met->Lys |
-2.945522 |
Met->Lys substitution |
M |
UNIMOD:614 |
Met->Xle |
-17.956421 |
Also Met->norleucine, Met->Leu/Ile substitution |
M |
UNIMOD:615 |
Met->Val |
-31.972071 |
Met->Val substitution |
M |
UNIMOD:616 |
Asn->Ser |
-27.010899 |
Asn->Ser substitution |
N |
UNIMOD:617 |
Asn->Thr |
-12.995249 |
Asn->Thr substitution |
N |
UNIMOD:618 |
Asn->Lys |
14.052036 |
Asn->Lys substitution |
N |
UNIMOD:619 |
Asn->Tyr |
49.020401 |
Asn->Tyr substitution |
N |
UNIMOD:620 |
Asn->His |
23.015984 |
Asn->His substitution |
N |
UNIMOD:621 |
Asn->Asp |
0.984016 |
Asn->Asp substitution |
N |
UNIMOD:622 |
Asn->Xle |
-0.958863 |
Asn->Leu/Ile substitution |
N |
UNIMOD:623 |
Pro->Ser |
-10.020735 |
Pro->Ser substitution |
P |
UNIMOD:624 |
Pro->Ala |
-26.01565 |
Pro->Ala substitution |
P |
UNIMOD:625 |
Pro->His |
40.006148 |
Pro->His substitution |
P |
UNIMOD:626 |
Pro->Gln |
31.005814 |
Pro->Gln substitution |
P |
UNIMOD:627 |
Pro->Thr |
3.994915 |
Pro->Thr substitution |
P |
UNIMOD:628 |
Pro->Arg |
59.048347 |
Pro->Arg substitution |
P |
UNIMOD:629 |
Pro->Xle |
16.0313 |
Pro->Leu/Ile substitution |
P |
UNIMOD:630 |
Gln->Pro |
-31.005814 |
Gln->Pro substitution |
Q |
UNIMOD:631 |
Gln->Lys |
0.036386 |
Gln->Lys substitution |
Q |
UNIMOD:632 |
Gln->Glu |
0.984016 |
Gln->Glu substitution |
Q |
UNIMOD:633 |
Gln->His |
9.000334 |
Gln->His substitution |
Q |
UNIMOD:634 |
Gln->Arg |
28.042534 |
Gln->Arg substitution |
Q |
UNIMOD:635 |
Gln->Xle |
-14.974514 |
Gln->Leu/Ile substitution |
Q |
UNIMOD:636 |
Arg->Ser |
-69.069083 |
Arg->Ser substitution |
R |
UNIMOD:637 |
Arg->Trp |
29.978202 |
Arg->Trp substitution |
R |
UNIMOD:638 |
Arg->Thr |
-55.053433 |
Arg->Thr substitution |
R |
UNIMOD:639 |
Arg->Pro |
-59.048347 |
Arg->Pro substitution |
R |
UNIMOD:640 |
Arg->Lys |
-28.006148 |
Arg->Lys substitution |
R |
UNIMOD:641 |
Arg->His |
-19.042199 |
Arg->His substitution |
R |
UNIMOD:642 |
Arg->Gln |
-28.042534 |
Arg->Gln substitution |
R |
UNIMOD:643 |
Arg->Met |
-25.060626 |
Arg->Met substitution |
R |
UNIMOD:644 |
Arg->Cys |
-53.091927 |
Arg->Cys substitution |
R |
UNIMOD:645 |
Arg->Xle |
-43.017047 |
Arg->Leu/Ile substitution |
R |
UNIMOD:646 |
Arg->Gly |
-99.079647 |
Arg->Gly substitution |
R |
UNIMOD:647 |
Ser->Phe |
60.036386 |
Ser->Phe substitution |
S |
UNIMOD:648 |
Ser->Ala |
-15.994915 |
Ser->Ala substitution |
S |
UNIMOD:649 |
Ser->Trp |
99.047285 |
Ser->Trp substitution |
S |
UNIMOD:650 |
Ser->Thr |
14.01565 |
Ser->Thr substitution |
S |
UNIMOD:651 |
Ser->Asn |
27.010899 |
Ser->Asn substitution |
S |
UNIMOD:652 |
Ser->Pro |
10.020735 |
Ser->Pro substitution |
S |
UNIMOD:653 |
Ser->Tyr |
76.0313 |
Ser->Tyr substitution |
S |
UNIMOD:654 |
Ser->Cys |
15.977156 |
Ser->Cys substitution |
S |
UNIMOD:655 |
Ser->Arg |
69.069083 |
Ser->Arg substitution |
S |
UNIMOD:656 |
Ser->Xle |
26.052036 |
Ser->Leu/Ile substitution |
S |
UNIMOD:657 |
Ser->Gly |
-30.010565 |
Ser->Gly substitution |
S |
UNIMOD:658 |
Thr->Ser |
-14.01565 |
Thr->Ser substitution |
T |
UNIMOD:659 |
Thr->Ala |
-30.010565 |
Thr->Ala substitution |
T |
UNIMOD:660 |
Thr->Asn |
12.995249 |
Thr->Asn substitution |
T |
UNIMOD:661 |
Thr->Lys |
27.047285 |
Thr->Lys substitution |
T |
UNIMOD:662 |
Thr->Pro |
-3.994915 |
Thr->Pro substitution |
T |
UNIMOD:663 |
Thr->Met |
29.992806 |
Thr->Met substitution |
T |
UNIMOD:664 |
Thr->Xle |
12.036386 |
Thr->Leu/Ile substitution |
T |
UNIMOD:665 |
Thr->Arg |
55.053433 |
Thr->Arg substitution |
T |
UNIMOD:666 |
Val->Phe |
48.0 |
Val->Phe substitution |
V |
UNIMOD:667 |
Val->Ala |
-28.0313 |
Val->Ala substitution |
V |
UNIMOD:668 |
Val->Glu |
29.974179 |
Val->Glu substitution |
V |
UNIMOD:669 |
Val->Met |
31.972071 |
Val->Met substitution |
V |
UNIMOD:670 |
Val->Asp |
15.958529 |
Val->Asp substitution |
V |
UNIMOD:671 |
Val->Xle |
14.01565 |
Val->Leu/Ile substitution |
V |
UNIMOD:672 |
Val->Gly |
-42.04695 |
Val->Gly substitution |
V |
UNIMOD:673 |
Trp->Ser |
-99.047285 |
Trp->Ser substitution |
W |
UNIMOD:674 |
Trp->Cys |
-83.070128 |
Trp->Cys substitution |
W |
UNIMOD:675 |
Trp->Arg |
-29.978202 |
Trp->Arg substitution |
W |
UNIMOD:676 |
Trp->Gly |
-129.057849 |
Trp->Gly substitution |
W |
UNIMOD:677 |
Trp->Xle |
-72.995249 |
Trp->Leu/Ile substitution |
W |
UNIMOD:678 |
Tyr->Phe |
-15.994915 |
Tyr->Phe substitution |
Y |
UNIMOD:679 |
Tyr->Ser |
-76.0313 |
Tyr->Ser substitution |
Y |
UNIMOD:680 |
Tyr->Asn |
-49.020401 |
Tyr->Asn substitution |
Y |
UNIMOD:681 |
Tyr->His |
-26.004417 |
Tyr->His substitution |
Y |
UNIMOD:682 |
Tyr->Asp |
-48.036386 |
Tyr->Asp substitution |
Y |
UNIMOD:683 |
Tyr->Cys |
-60.054144 |
Tyr->Cys substitution |
Y |
UNIMOD:684 |
BDMAPP |
253.010225 |
Mass Defect Tag on lysine e-amino |
H, N-term, K, W, Y |
UNIMOD:685 |
NA-LNO2 |
325.225309 |
Michael addition of nitro-linoleic acid to Cys and His, Nitroalkylation by Nitro Linoleic Acid |
H, C |
UNIMOD:686 |
NA-OA-NO2 |
327.240959 |
Nitroalkylation by Nitro Oleic Acid, Michael addition of nitro-oleic acid to Cys and His |
H, C |
UNIMOD:687 |
ICPL:2H(4) |
109.046571 |
ICPL_medium, Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, medium form |
N-term, K |
UNIMOD:695 |
Label:13C(6)15N(1) |
7.017164 |
13C(6) 15N(1) Silac label |
I, L |
UNIMOD:696 |
13C6-15N2-D9 |
17.07069 |
Label:2H(9)13C(6)15N(2), 13C(6) 15N(2) (D)9 SILAC label, heavy D9 lysine |
K |
UNIMOD:697 |
NIC |
105.021464 |
Nicotinic Acid |
N-term, K |
UNIMOD:698 |
dNIC |
109.048119 |
deuterated Nicotinic Acid |
N-term, K |
UNIMOD:720 |
HNE-Delta:H(2)O |
138.104465 |
Dehydrated 4-hydroxynonenal |
K, H, C |
UNIMOD:721 |
4-ONE |
154.09938 |
4-Oxononenal (ONE) |
K, H, C |
UNIMOD:723 |
O-Dimethylphosphate |
107.997631 |
O-Dimethylphosphorylation |
S, Y, T |
UNIMOD:724 |
O-Methylphosphate |
93.981981 |
O-Methylphosphorylation |
S, Y, T |
UNIMOD:725 |
Diethylphosphate |
136.028931 |
O-Diethylphosphorylation |
H, C, N-term, K, S, T, Y |
UNIMOD:726 |
Ethylphosphate |
107.997631 |
O-Ethylphosphorylation |
N-term, K, S, T, Y |
UNIMOD:727 |
O-pinacolylmethylphosphonate |
162.080967 |
O-pinacolylmethylphosphonylation |
H, K, S, T, Y |
UNIMOD:728 |
Methylphosphonate |
77.987066 |
Methylphosphonylation |
S, Y, T |
UNIMOD:729 |
O-Isopropylmethylphosphonate |
120.034017 |
O-Isopropylmethylphosphonylation |
S, Y, T |
UNIMOD:730 |
iTRAQ8plex |
304.20536 |
AKA iTRAQ8plex:13C(7)15N(1), Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry, Representative mass and accurate mass for 113, 114, 116 & 117 |
S, T, H, C, N-term, K, Y |
UNIMOD:731 |
iTRAQ8plex:13C(6)15N(2) |
304.19904 |
Applied Biosystems iTRAQ(TM) multiplexed quantitation chemistry, Accurate mass for 115, 118, 119 & 121 |
N-term, K, Y, C |
UNIMOD:734 |
Ethanolamine |
43.042199 |
Carboxyl modification with ethanolamine |
C-term, D, E, C |
UNIMOD:735 |
BEMAD_ST |
136.001656 |
T followed by Michael addition of DTT, Beta elimination of modified S or T followed by Michael addition of DTT, Was DTT_ST, Beta elimination of modified S, threo-1,4-dimercaptobutane-2,3-diol |
S, T |
UNIMOD:736 |
BEMAD_C |
120.0245 |
Was DTT_C, Beta elimination of alkylated Cys followed by Michael addition of DTT |
C |
UNIMOD:737 |
TMT6plex |
229.162932 |
Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc., Tandem Mass Tag sixplex labelling kit Proteome Sciences, Sixplex Tandem Mass Tag®, This is a nominal. representative mass, Also applies to TMT10plex |
H, N-term, K, S, T |
UNIMOD:738 |
TMT2plex |
225.155833 |
Duplex Tandem Mass Tag®, Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc., Tandem Mass Tag Duplex labelling kit Proteome Sciences |
H, N-term, K, S, T |
UNIMOD:739 |
TMT |
224.152478 |
Native Tandem Mass Tag®, Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. |
H, N-term, K, S, T |
UNIMOD:740 |
ExacTagThiol |
972.365219 |
ExacTag Thiol label mass for 2-4-7-10 plex, PerkinElmer ExacTag Thiol kit |
C |
UNIMOD:741 |
ExacTagAmine |
1046.347854 |
ExacTag Amine label mass for 2-4-7-10 plex, PerkinElmer ExacTag Amine kit |
K |
UNIMOD:743 |
4-ONE+Delta:H(-2)O(-1) |
136.088815 |
Dehydrated 4-Oxononenal Michael adduct |
K, H, C |
UNIMOD:744 |
NO_SMX_SEMD |
251.036462 |
Nitroso Sulfamethoxazole Sulphenamide thiol adduct |
C |
UNIMOD:746 |
NO_SMX_SIMD |
267.031377 |
Nitroso Sulfamethoxazole Sulfinamide thiol adduct |
C |
UNIMOD:747 |
Malonyl |
86.000394 |
Malonylation |
S, K, C |
UNIMOD:748 |
3sulfo |
183.983029 |
derivatization by N-term modification using 3-Sulfobenzoic succinimidyl ester |
N-term |
UNIMOD:750 |
trifluoro |
53.971735 |
trifluoroleucine replacement of leucine |
L |
UNIMOD:751 |
TNBS |
210.986535 |
tri nitro benzene |
N-term, K |
UNIMOD:762 |
IDEnT |
214.990469 |
Isotope Distribution Encoded Tag, 2,4-dichlorobenzylcarbamidomethyl |
C |
UNIMOD:763 |
BEMAD_ST:2H(6) |
142.039317 |
Beta elimination of modified S, Was DTT_ST:2H(6), T followed by Michael addition of labelled DTT, Beta elimination of modified S or T followed by Michael addition of labelled DTT |
S, T |
UNIMOD:764 |
BEMAD_C:2H(6) |
126.062161 |
Beta elimination of alkylated Cys followed by Michael addition of labelled DTT, Isotopically labeled Dithiothreitol (DTT) modification of cysteines, Was DTT_C:2H(6) |
C |
UNIMOD:765 |
Met-loss |
-131.040485 |
Removal of initiator methionine from protein N-terminus |
M @ Protein N-term |
UNIMOD:766 |
Met-loss+Acetyl |
-89.02992 |
Removal of initiator methionine from protein N-terminus, then acetylation of the new N-terminus |
M @ Protein N-term |
UNIMOD:767 |
Menadione-HQ |
172.05243 |
Menadione hydroquinone derivative |
K, C |
UNIMOD:768 |
Methyl+Acetyl:2H(3) |
59.045045 |
Mono-methylated lysine labelled with Acetyl_heavy |
K |
UNIMOD:771 |
lapachenole |
240.11503 |
lapachenole photochemically added to cysteine |
C |
UNIMOD:772 |
13C5 |
5.016774 |
Label:13C(5), 13C(5) Silac label |
P |
UNIMOD:773 |
maleimide |
97.016378 |
K, C |
|
UNIMOD:774 |
Biotin-phenacyl |
626.263502 |
Alkylation by biotinylated form of phenacyl bromide |
S, H, C |
UNIMOD:775 |
Carboxymethyl:13C(2) |
60.012189 |
Iodoacetic acid derivative w/ 13C label, Carboxymethylation w/ 13C label |
C |
UNIMOD:776 |
CysNEM D5 |
130.079062 |
NEM:2H(5), D5 N-ethylmaleimide on cysteines |
C |
UNIMOD:792 |
T |
63.044462 |
AEC-MAEC:2H(4), deuterium cysteamine modification to S or T, deuterium cysteamine modification to S |
S, |
UNIMOD:793 |
Hex1HexNAc1 |
365.132196 |
Hex(1)HexNAc(1) |
S, N, T |
UNIMOD:799 |
Label:13C(6)+GG |
120.063056 |
13C6 labeled ubiquitinylation residue |
K |
UNIMOD:800 |
Biotin:Thermo-21345 |
311.166748 |
Used for labeling glutamine-donor substrate of transglutaminase, was PentylamineBiotin |
Q |
UNIMOD:801 |
Pentylamine |
70.07825 |
Labeling transglutaminase substrate on glutamine side chain |
Q |
UNIMOD:811 |
Biotin:Thermo-21360 |
487.246455 |
Pierce EZ link biotin hydrazide prod no. 21360, was Biotin-PEO4-hydrazide |
|
UNIMOD:821 |
Cy3b-maleimide |
682.24612 |
Formula requires confirmation, Cy3b meleimide reacted with Cysteine, fluorescent dye that labels cysteines |
C |
UNIMOD:822 |
Gly-loss+Amide |
-58.005479 |
Enzymatic glycine removal leaving an amidated C-terminus, Amidation requires presence of glycine at peptide terminus |
G @ C-term |
UNIMOD:824 |
Intact |
220.048407 |
monolink BMOE crosslinker, Intact or monolink BMOE crosslinker, Xlink:BMOE |
C |
UNIMOD:825 |
Xlink:DFDNB |
163.985807 |
Intact DFDNB crosslinker |
Q, N, K, R |
UNIMOD:827 |
TMPP-Ac |
572.181134 |
tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester derivative |
N-term, K, Y |
UNIMOD:830 |
Dihydroxyimidazolidine |
72.021129 |
Dihydroxy methylglyoxal adduct |
R |
UNIMOD:834 |
Acetyl_K4 |
46.035672 |
Acetyl 4,4,5,5-D4 Lysine, Label:2H(4)+Acetyl |
K |
UNIMOD:835 |
Label:13C(6)+Acetyl |
48.030694 |
Acetyl 13C(6) Silac label |
K |
UNIMOD:836 |
Acetyl_heavy lysine |
50.024764 |
Acetyl_13C(6) 15N(2) Silac label, Label:13C(6)15N(2)+Acetyl |
K |
UNIMOD:837 |
Arg->Npo |
80.985078 |
Arginine replacement by Nitropyrimidyl ornithine |
R |
UNIMOD:846 |
EQIGG |
484.228162 |
Sumoylation, Sumo mutant Smt3-WT tail following trypsin digestion |
K |
UNIMOD:848 |
Arg2PG |
266.057909 |
Adduct of phenylglyoxal with Arg |
R |
UNIMOD:849 |
cGMP |
343.031785 |
S-guanylation |
S, C |
UNIMOD:851 |
cGMP+RMP-loss |
150.041585 |
S-guanylation-2 |
S, C |
UNIMOD:853 |
Label:2H(4)+GG |
118.068034 |
Ubiquitination 2H4 lysine |
K |
UNIMOD:859 |
MG-H1 |
54.010565 |
Methylglyoxal-derived hydroimidazolone |
R |
UNIMOD:860 |
G-H1 |
39.994915 |
Glyoxal-derived hydroimiadazolone |
R |
UNIMOD:861 |
ZGB |
758.380841 |
NHS ester linked Green Fluorescent Bodipy Dye |
N-term, K |
UNIMOD:862 |
SILAC |
4.022185 |
Label:13C(1)2H(3) |
M |
UNIMOD:864 |
heavy glygly lysine |
122.057126 |
13C(6) 15N(2) Lysine glygly, Label:13C(6)15N(2)+GG |
K |
UNIMOD:866 |
ICPL_10 |
115.0667 |
Bruker Daltonics SERVA-ICPL(TM) quantification chemistry, +10 Da form, ICPL:13C(6)2H(4) |
N-term, K |
UNIMOD:876 |
QEQTGG |
600.250354 |
GlnGluGlnThrGlyGly, SUMOylation by SUMO-1 |
K |
UNIMOD:877 |
QQQTGG |
599.266339 |
SUMOylation by SUMO-2/3, GlnGlnGlnThrGlyGly |
K |
UNIMOD:884 |
was ChromoBiotin |
695.310118 |
EZ-Link NHS-Chromogenic Biotin, Biotin:Thermo-21325 |
K |
UNIMOD:885 |
Label:13C(1)2H(3)+Oxidation |
20.0171 |
Oxidised methionine 13C(1)2H(3) SILAC label |
M |
UNIMOD:886 |
HydroxymethylOP |
108.021129 |
2-ammonio-6-[4-(hydroxymethyl)-3-oxidopyridinium-1-yl]- hexanoate |
K |
UNIMOD:887 |
MDCC |
383.148121 |
CAS 156571-46-9, covalent linkage of maleimidyl coumarin probe (Molecular Probes D-10253), 7-diethylamino-3-((((2-maleimidyl)ethyl)amino)carbonyl)coumarin |
C |
UNIMOD:888 |
mTRAQ |
140.094963 |
Applied Biosystems mTRAQ(TM) reagent, mTRAQ light |
H, N-term, K, S, T, Y |
UNIMOD:889 |
mTRAQ medium |
144.102063 |
Applied Biosystems mTRAQ(TM) reagent, mTRAQ:13C(3)15N(1), mTRAQ medium is identical to iTRAQ4plex 117 |
H, N-term, K, S, T, Y |
UNIMOD:890 |
DyLight-maleimide |
940.1999 |
Thiol-reactive dye for fluorescence labelling of proteins |
C |
UNIMOD:891 |
Methyl-PEO12-Maleimide |
710.383719 |
C |
|
UNIMOD:893 |
CarbamidomethylDTT |
209.018035 |
Carbamidomethylated DTT modification of cysteine |
C |
UNIMOD:894 |
CarboxymethylDTT |
210.00205 |
Carboxymethylated DTT modification of cysteine |
C |
UNIMOD:895 |
Biotin-PEG-PRA |
578.317646 |
Biotin polyethyleneoxide (n=3) alkyne |
M |
UNIMOD:896 |
Met->Aha |
-4.986324 |
Methionine replacement by azido homoalanine |
M |
UNIMOD:897 |
Label:15N(4) |
3.98814 |
Metabolic labeling with ammonium sulfate (15N), SILAC 15N(4) |
R |
UNIMOD:898 |
pyrophospho |
159.932662 |
pyrophosphorylation of Ser/Thr |
S, T |
UNIMOD:899 |
Met->Hpg |
-21.987721 |
methionine replacement by homopropargylglycine |
M |
UNIMOD:901 |
4AcAllylGal |
372.142033 |
2,3,4,6-tetra-O-Acetyl-1-allyl-alpha-D-galactopyranoside modification of cysteine |
C |
UNIMOD:902 |
DimethylArsino |
103.960719 |
Reaction with dimethylarsinous (AsIII) acid |
C |
UNIMOD:903 |
Lys->CamCys |
31.935685 |
Lys->Cys substitution and carbamidomethylation |
K |
UNIMOD:904 |
Phe->CamCys |
12.962234 |
Phe->Cys substitution and carbamidomethylation |
F |
UNIMOD:905 |
Leu->MetOx |
33.951335 |
Leu->Met substitution and sulfoxidation |
L |
UNIMOD:906 |
Lys->MetOx |
18.940436 |
Lys->Met substitution and sulfoxidation |
K |
UNIMOD:907 |
Galactosyl |
178.047738 |
Gluconoylation |
N-term, K |
UNIMOD:908 |
Xlink:SMCC[321] |
321.205242 |
Monolink of SMCC terminated with 3-(dimethylamino)-1-propylamine |
C |
UNIMOD:910 |
DATDH |
228.111007 |
Bacillosamine, 2,4-diacetamido-2,4,6-trideoxyglucopyranose, Asn-linked glycan from Gram-negative Bacterium |
N |
UNIMOD:911 |
MTSL |
184.07961 |
Cys modification by (1-oxyl-2,2,5,5-tetramethyl-3-pyrroline-3-methyl)methanesulfonate (MTSL) |
C |
UNIMOD:912 |
HNE-BAHAH |
511.319226 |
4-hydroxy-2-nonenal and biotinamidohexanoic acid hydrazide, reduced |
K, H, C |
UNIMOD:914 |
Methylmalonylation |
100.016044 |
Methylmalonylation on Serine |
S |
UNIMOD:926 |
ethylamino |
27.047285 |
ethyl amino |
S, T |
UNIMOD:928 |
MercaptoEthanol |
60.003371 |
2-OH-ethyl thio-Ser |
S, T |
UNIMOD:931 |
Ethyl+Deamidated |
29.015316 |
deamidation followed by esterification with ethanol |
N, Q |
UNIMOD:932 |
VFQQQTGG |
845.403166 |
SUMOylation by SUMO-2/3 (formic acid cleavage), ValPheGlnGlnGlnThrGlyGly |
K |
UNIMOD:933 |
VIEVYQEQTGG |
1203.577168 |
ValIleGluValTyrGlnGluGlnThrGlyGly, SUMOylation by SUMO-1 (formic acid cleavage) |
K |
UNIMOD:934 |
AMTzHexNAc2 |
502.202341 |
Photocleavable Biotin + GalNAz on O-GlcNAc |
S, N, T |
UNIMOD:935 |
Atto495Maleimide |
474.250515 |
High molecular absorption maleimide label for proteins |
C |
UNIMOD:936 |
Chlorination |
33.961028 |
Chlorination of tyrosine residues |
W, Y |
UNIMOD:937 |
Dichlorination |
67.922055 |
dichlorination |
Y, C |
UNIMOD:938 |
AROD |
820.336015 |
Cysteine modifier |
C |
UNIMOD:939 |
Cys->methylaminoAla |
-2.945522 |
carbamidomethylated Cys that undergoes beta-elimination and Michael addition of methylamine |
C |
UNIMOD:940 |
Cys->ethylaminoAla |
11.070128 |
Carbamidomethylated Cys that undergoes beta-elimination and Michael addition of ethylamine |
C |
UNIMOD:941 |
DNPS |
198.981352 |
Trp modification with 2,4-Dinitrobenzenesulfenyl, 2,4-Dinitrobenzenesulfenyl |
W, C |
UNIMOD:942 |
SulfoGMBS |
458.162391 |
High molecular absorption label for proteins |
C |
UNIMOD:943 |
DimethylamineGMBS |
267.158292 |
Modified GMBS X linker |
C |
UNIMOD:944 |
SILAC label |
11.050561 |
Label:15N(2)2H(9) |
K |
UNIMOD:946 |
LG-anhydrolactam |
314.188195 |
Levuglandinyl-lysine anhydrolactam adduct |
N-term, K |
UNIMOD:947 |
LG-pyrrole |
316.203845 |
Levuglandinyl-lysine pyrrole adduct |
N-term, K, C |
UNIMOD:948 |
LG-anhyropyrrole |
298.19328 |
Levuglandinyl-lysine anhyropyrrole adduct |
N-term, K |
UNIMOD:949 |
3-deoxyglucosone |
144.042259 |
Condensation product of 3-deoxyglucosone |
R |
UNIMOD:950 |
Cation:Li |
6.008178 |
Replacement of proton by lithium |
D, C-term, E |
UNIMOD:951 |
Cation:Ca[II] |
37.946941 |
Replacement of 2 protons by calcium |
D, C-term, E |
UNIMOD:952 |
Cation:Fe[II] |
53.919289 |
Replacement of 2 protons by iron |
D, C-term, E |
UNIMOD:953 |
Cation:Ni[II] |
55.919696 |
Replacement of 2 protons by nickel |
D, C-term, E |
UNIMOD:954 |
Cation:Zn[II] |
61.913495 |
Replacement of 2 protons by zinc |
D, C-term, E, H |
UNIMOD:955 |
Cation:Ag |
105.897267 |
Replacement of proton by silver |
D, C-term, E |
UNIMOD:956 |
Cation:Mg[II] |
21.969392 |
Replacement of 2 protons by magnesium |
D, C-term, E |
UNIMOD:957 |
2-succinyl |
116.010959 |
S-(2-succinyl) cysteine |
C |
UNIMOD:958 |
propargylamine |
37.031634 |
Propargylamine |
C-term, D, E |
UNIMOD:959 |
Phosphopropargyl |
116.997965 |
phospho-propargylamine |
S, Y, T |
UNIMOD:960 |
SUMO2135 |
2135.920496 |
ELGMEEEDVIEVYQEQTGG, SUMOylation by SUMO-1 after tryptic cleavage |
K |
UNIMOD:961 |
SUMO3549 |
3549.536568 |
FDGQPINETDTPAQLEMEDEDTIDVFQQQTGG, SUMOylation by SUMO-2/3 after tryptic cleavage |
K |
UNIMOD:967 |
thioacylPA |
159.035399 |
membrane protein extraction |
K |
UNIMOD:971 |
maleimide3 |
969.366232 |
maleimide-3-saccharide |
K, C |
UNIMOD:972 |
maleimide5 |
1293.471879 |
maleimide-5-saccharide |
K, C |
UNIMOD:973 |
Puromycin |
453.212452 |
C-term |
|
UNIMOD:977 |
Carbofuran |
57.021464 |
2,3-dihydro-2,2-dimethyl-7-benzofuranol N-methyl carbamate |
S |
UNIMOD:978 |
BITC |
149.02992 |
Benzyl isothiocyanate |
N-term, K, C |
UNIMOD:979 |
PEITC |
163.04557 |
Phenethyl isothiocyanate |
N-term, K, C |
UNIMOD:981 |
glucosone |
160.037173 |
Condensation product of glucosone |
R |
UNIMOD:984 |
cysTMT |
299.166748 |
Native cysteine-reactive Tandem Mass Tag®, Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. |
C |
UNIMOD:985 |
cysTMT6plex |
304.177202 |
cysteine-reactive Sixplex Tandem Mass Tag®, Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. |
C |
UNIMOD:986 |
Label:13C(6)+Dimethyl |
34.051429 |
Dimethyl 13C(6) Silac label |
K |
UNIMOD:987 |
Label:13C(6)15N(2)+Dimethyl |
36.045499 |
Dimethyl 13C(6)15N(2) Silac label |
K |
UNIMOD:989 |
Ammonium |
17.026549 |
replacement of proton with ammonium ion |
C-term, D, E |
UNIMOD:991 |
ISD_z+2_ion |
-15.010899 |
ISD (z+2)-series |
N-term |
UNIMOD:993 |
Biotin:Sigma-B1267 |
449.17329 |
maleimide biotinylated, was Biotin-maleimide |
C |
UNIMOD:994 |
15N(1) |
0.997035 |
Label:15N(1), Metabolic labeling with ammonium sulfate (15N) |
C, V, M, G, A, S, F, P, D, T, E, I, Y, L |
UNIMOD:995 |
15N(2) |
1.99407 |
Label:15N(2), Metabolic labeling with ammonium sulfate (15N) |
W, N, Q, K |
UNIMOD:996 |
15N(3) |
2.991105 |
Label:15N(3), Metabolic labeling with ammonium sulfate (15N) |
H |
UNIMOD:997 |
sulfo+amino |
94.967714 |
aminotyrosine with sulfation, amino_sulfate |
Y |
UNIMOD:1000 |
AHA-Alkyne |
107.077339 |
Azidohomoalanine (AHA) bound to propargylglycine-NH2 (alkyne) |
M |
UNIMOD:1001 |
AHA-Alkyne-KDDDD |
695.280074 |
Azidohomoalanine (AHA) bound to DDDDK-propargylglycine-NH2 (alkyne) |
M |
UNIMOD:1002 |
EGCG1 |
456.069261 |
(-)-epigallocatechin-3-gallate |
C |
UNIMOD:1003 |
EGCG2 |
287.055563 |
(-)-dehydroepigallocatechin |
C |
UNIMOD:1004 |
Label:13C(6)15N(4)+Methyl |
24.023919 |
Monomethylated Arg13C(6) 15N(4) |
R |
UNIMOD:1005 |
Label:13C(6)15N(4)+Dimethyl |
38.039569 |
Dimethylated Arg13C(6) 15N(4) |
R |
UNIMOD:1006 |
Label:13C(6)15N(4)+Methyl:2H(3)13C(1) |
28.046104 |
2H(3) 13C(1) monomethylated Arg13C(6) 15N(4) |
R |
UNIMOD:1007 |
Label:13C(6)15N(4)+Dimethyl:2H(6)13C(2) |
46.083939 |
2H(6) 13C(2) Dimethylated Arg13C(6) 15N(4) |
R |
UNIMOD:1008 |
Cys->CamSec |
104.965913 |
Carboxyamidomethylation of selenocysteine, Sec Iodoacetamide derivative |
C |
UNIMOD:1009 |
Thiazolidine |
12.0 |
formaldehyde adduct, thiazolidine-2-carboxylic acid |
H, C, N-term, K, W, F, R, Y |
UNIMOD:1010 |
DEDGFLYMVYASQETFG |
1970.824411 |
Addition of DEDGFLYMVYASQETFG |
K |
UNIMOD:1012 |
Biotin:Invitrogen-M1602 |
523.210069 |
Reference M1602 Invitrogen, Nalpha-(3-maleimidylpropionyl)biocytin |
C |
UNIMOD:1014 |
glycidamide |
87.032028 |
glycidamide adduct |
N-term, K |
UNIMOD:1015 |
Ahx2+Hsl |
309.205242 |
C-terminal homoserine lactone and two aminohexanoic acids |
C-term |
UNIMOD:1017 |
DMPO |
111.068414 |
DMPO spin-trap nitrone adduct |
Y, H, C |
UNIMOD:1018 |
ICDID |
138.06808 |
Isotope-Coded Dimedone light form |
C |
UNIMOD:1019 |
ICDID:2H(6) |
144.10574 |
Isotope-Coded Dimedone heavy form |
C |
UNIMOD:1020 |
Xlink:DSS[156] |
156.078644 |
Water-quenched monolink of DSS/BS3 crosslinker |
N-term, K |
UNIMOD:1021 |
Xlink:EGS[244] |
244.058303 |
Ethylene glycolbis(succinimidylsuccinate), Water quenched monolink of EGS cross-linker |
N-term, K |
UNIMOD:1022 |
Xlink:DST[132] |
132.005873 |
Water quenched monolink of DST crosslinker |
N-term, K |
UNIMOD:1023 |
Xlink:DTSSP[192] |
191.991486 |
Water quenched monolink of DSP/DTSSP crosslinker, Also known as DSP |
N-term, K |
UNIMOD:1024 |
Xlink:SMCC[237] |
237.100108 |
Water quenched monolink of SMCC |
N-term, K, C |
UNIMOD:1027 |
Xlink:DMP[140] |
140.094963 |
Dimethyl pimelimidate dead-end crosslink, Water quenched monolink of DMP crosslinker |
N-term, K |
UNIMOD:1028 |
Xlink:EGS[115] |
115.026943 |
Ethylene glycolbis(succinimidylsuccinate), Cleavage product of EGS protein crosslinks by hydroylamine treatment |
N-term, K |
UNIMOD:1031 |
desthiobiotin-GTP |
196.121178 |
desthiobiotin-ADP, Biotin:Thermo-88310, desthiobiotin-ATP, desthiobiotin modification of lysine |
K |
UNIMOD:1032 |
2-nitrobenzyl |
135.032028 |
Tyrosine caged with 2-nitrobenzyl (ONB) |
Y |
UNIMOD:1033 |
SecNEM |
172.992127 |
N-ethylmaleimide on selenocysteines, Cys->SecNEM |
C |
UNIMOD:1034 |
SecNEM D5 |
178.023511 |
Cys->SecNEM:2H(5), D5 N-ethylmaleimide on selenocysteines |
C |
UNIMOD:1035 |
Thiadiazole |
174.025169 |
Thiadiazolydation of Cys |
C |
UNIMOD:1036 |
Withaferin |
470.266839 |
Modification of cystein by withaferin |
C |
UNIMOD:1037 |
desthiobiotin-FP |
443.291294 |
desthiobiotin fluorophosphonate, Biotin:Thermo-88317, desthiobiotin-alkyl-FP |
S, Y |
UNIMOD:1038 |
TAMRA-FP |
659.312423 |
TAMRA-alkyl-FP, TAMRA fluorophosphonate modification of serine, ActivX TAMRA-FP Serine Hydrolase Probe |
S, Y |
UNIMOD:1039 |
Biotin:Thermo-21901+H2O |
543.236284 |
Maleimide-PEG2-Biotin + Water, Maleimide-Biotin + Water |
C |
UNIMOD:1041 |
Deoxyhypusine |
71.073499 |
Q, K |
|
UNIMOD:1042 |
Acetyldeoxyhypusine |
113.084064 |
K |
|
UNIMOD:1043 |
Acetylhypusine |
129.078979 |
K |
|
UNIMOD:1044 |
Ala->Cys |
31.972071 |
Ala->Cys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1045 |
Ala->Phe |
76.0313 |
Ala->Phe substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1046 |
Ala->His |
66.021798 |
Ala->His substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1047 |
Ala->Xle |
42.04695 |
Ala->Leu/Ile substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1048 |
Ala->Lys |
57.057849 |
Ala->Lys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1049 |
Ala->Met |
60.003371 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Ala->Met substitution, editing of the charged tRNA |
A |
UNIMOD:1050 |
Ala->Asn |
43.005814 |
Misacylation of the tRNA or editing of the charged tRNA, Ala->Asn substitution, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1051 |
Ala->Gln |
57.021464 |
Ala->Gln substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1052 |
Ala->Arg |
85.063997 |
Ala->Arg substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1053 |
Ala->Trp |
115.042199 |
Ala->Trp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1054 |
Ala->Tyr |
92.026215 |
Misacylation of the tRNA or editing of the charged tRNA, Ala->Tyr substitution, Misacylation of the tRNA, editing of the charged tRNA |
A |
UNIMOD:1055 |
Cys->Ala |
-31.972071 |
Cys->Ala substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
C |
UNIMOD:1056 |
Cys->Asp |
12.017759 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Cys->Asp substitution, editing of the charged tRNA |
C |
UNIMOD:1057 |
Cys->Glu |
26.033409 |
Cys->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
C |
UNIMOD:1058 |
Cys->His |
34.049727 |
Cys->His substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
C |
UNIMOD:1059 |
Cys->Xle |
10.07488 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Cys->Leu/Ile substitution |
C |
UNIMOD:1060 |
Cys->Lys |
25.085779 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Cys->Lys substitution, editing of the charged tRNA |
C |
UNIMOD:1061 |
Cys->Met |
28.0313 |
Cys->Met substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
C |
UNIMOD:1062 |
Cys->Asn |
11.033743 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Cys->Asn substitution, editing of the charged tRNA |
C |
UNIMOD:1063 |
Cys->Pro |
-5.956421 |
Cys->Pro substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
C |
UNIMOD:1064 |
Cys->Gln |
25.049393 |
Misacylation of the tRNA or editing of the charged tRNA, Cys->Gln substitution, Misacylation of the tRNA, editing of the charged tRNA |
C |
UNIMOD:1065 |
Cys->Thr |
-1.961506 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Cys->Thr substitution, editing of the charged tRNA |
C |
UNIMOD:1066 |
Cys->Val |
-3.940771 |
Misacylation of the tRNA or editing of the charged tRNA, Cys->Val substitution, Misacylation of the tRNA, editing of the charged tRNA |
C |
UNIMOD:1067 |
Asp->Cys |
-12.017759 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asp->Cys substitution, editing of the charged tRNA |
D |
UNIMOD:1068 |
Asp->Phe |
32.041471 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asp->Phe substitution |
D |
UNIMOD:1069 |
Asp->Xle |
-1.942879 |
Asp->Leu/Ile substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
D |
UNIMOD:1070 |
Asp->Lys |
13.06802 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asp->Lys substitution, editing of the charged tRNA |
D |
UNIMOD:1071 |
Asp->Met |
16.013542 |
Asp->Met substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
D |
UNIMOD:1072 |
Asp->Pro |
-17.974179 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asp->Pro substitution, editing of the charged tRNA |
D |
UNIMOD:1073 |
Asp->Gln |
13.031634 |
Asp->Gln substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
D |
UNIMOD:1074 |
Asp->Arg |
41.074168 |
Asp->Arg substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
D |
UNIMOD:1075 |
Asp->Ser |
-27.994915 |
Misacylation of the tRNA or editing of the charged tRNA, Asp->Ser substitution, Misacylation of the tRNA, editing of the charged tRNA |
D |
UNIMOD:1076 |
Asp->Thr |
-13.979265 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asp->Thr substitution, editing of the charged tRNA |
D |
UNIMOD:1077 |
Asp->Trp |
71.05237 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asp->Trp substitution, editing of the charged tRNA |
D |
UNIMOD:1078 |
Glu->Cys |
-26.033409 |
Glu->Cys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1079 |
Glu->Phe |
18.025821 |
Glu->Phe substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1080 |
Glu->His |
8.016319 |
Glu->His substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1081 |
Glu->Xle |
-15.958529 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Glu->Leu/Ile substitution, editing of the charged tRNA |
E |
UNIMOD:1082 |
Glu->Met |
1.997892 |
Misacylation of the tRNA or editing of the charged tRNA, Glu->Met substitution, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1083 |
Glu->Asn |
-14.999666 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Glu->Asn substitution |
E |
UNIMOD:1084 |
Glu->Pro |
-31.989829 |
Glu->Pro substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1085 |
Glu->Arg |
27.058518 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Glu->Arg substitution, editing of the charged tRNA |
E |
UNIMOD:1086 |
Glu->Ser |
-42.010565 |
Glu->Ser substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1087 |
Glu->Thr |
-27.994915 |
Glu->Thr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1088 |
Glu->Trp |
57.03672 |
Glu->Trp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1089 |
Glu->Tyr |
34.020735 |
Glu->Tyr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
E |
UNIMOD:1090 |
Phe->Ala |
-76.0313 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Phe->Ala substitution |
F |
UNIMOD:1091 |
Phe->Asp |
-32.041471 |
Misacylation of the tRNA or editing of the charged tRNA, Phe->Asp substitution, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1092 |
Phe->Glu |
-18.025821 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Phe->Glu substitution |
F |
UNIMOD:1093 |
Phe->Gly |
-90.04695 |
Phe->Gly substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1094 |
Phe->His |
-10.009502 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Phe->His substitution, editing of the charged tRNA |
F |
UNIMOD:1095 |
Phe->Lys |
-18.973451 |
Phe->Lys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1096 |
Phe->Met |
-16.027929 |
Phe->Met substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1097 |
Phe->Asn |
-33.025486 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Phe->Asn substitution, editing of the charged tRNA |
F |
UNIMOD:1098 |
Phe->Pro |
-50.01565 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Phe->Pro substitution, editing of the charged tRNA |
F |
UNIMOD:1099 |
Phe->Gln |
-19.009836 |
Phe->Gln substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1100 |
Phe->Arg |
9.032697 |
Phe->Arg substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1101 |
Phe->Thr |
-46.020735 |
Phe->Thr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1102 |
Phe->Trp |
39.010899 |
Misacylation of the tRNA or editing of the charged tRNA, Phe->Trp substitution, Misacylation of the tRNA, editing of the charged tRNA |
F |
UNIMOD:1103 |
Gly->Phe |
90.04695 |
Misacylation of the tRNA or editing of the charged tRNA, Gly->Phe substitution, Misacylation of the tRNA, editing of the charged tRNA |
G |
UNIMOD:1104 |
Gly->His |
80.037448 |
Gly->His substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
G |
UNIMOD:1105 |
Gly->Xle |
56.0626 |
Gly->Leu/Ile substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
G |
UNIMOD:1106 |
Gly->Lys |
71.073499 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Gly->Lys substitution, editing of the charged tRNA |
G |
UNIMOD:1107 |
Gly->Met |
74.019021 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Gly->Met substitution, editing of the charged tRNA |
G |
UNIMOD:1108 |
Gly->Asn |
57.021464 |
Gly->Asn substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
G |
UNIMOD:1109 |
Gly->Pro |
40.0313 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Gly->Pro substitution, editing of the charged tRNA |
G |
UNIMOD:1110 |
Gly->Gln |
71.037114 |
Misacylation of the tRNA or editing of the charged tRNA, Gly->Gln substitution, Misacylation of the tRNA, editing of the charged tRNA |
G |
UNIMOD:1111 |
Gly->Thr |
44.026215 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Gly->Thr substitution |
G |
UNIMOD:1112 |
Gly->Tyr |
106.041865 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Gly->Tyr substitution |
G |
UNIMOD:1113 |
His->Ala |
-66.021798 |
His->Ala substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1114 |
His->Cys |
-34.049727 |
His->Cys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1115 |
His->Glu |
-8.016319 |
His->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1116 |
His->Phe |
10.009502 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, His->Phe substitution, editing of the charged tRNA |
H |
UNIMOD:1117 |
His->Gly |
-80.037448 |
His->Gly substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1119 |
His->Lys |
-8.963949 |
Misacylation of the tRNA, Misacylation of the tRNA or editing of the charged tRNA, His->Lys substitution, editing of the charged tRNA |
H |
UNIMOD:1120 |
His->Met |
-6.018427 |
Misacylation of the tRNA or editing of the charged tRNA, His->Met substitution, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1121 |
His->Ser |
-50.026883 |
His->Ser substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1122 |
His->Thr |
-36.011233 |
His->Thr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1123 |
His->Val |
-37.990498 |
His->Val substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1124 |
His->Trp |
49.020401 |
His->Trp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
H |
UNIMOD:1125 |
Xle->Ala |
-42.04695 |
Leu/Ile->Ala substitution |
I, L |
UNIMOD:1126 |
Xle->Cys |
-10.07488 |
Leu/Ile->Cys substitution |
I, L |
UNIMOD:1127 |
Xle->Asp |
1.942879 |
Leu/Ile->Asp substitution |
I, L |
UNIMOD:1128 |
Xle->Glu |
15.958529 |
Leu/Ile->Glu substitution |
I, L |
UNIMOD:1129 |
Xle->Gly |
-56.0626 |
Leu/Ile->Gly substitution |
I, L |
UNIMOD:1130 |
Xle->Tyr |
49.979265 |
Leu/Ile->Tyr substitution |
I, L |
UNIMOD:1131 |
Lys->Ala |
-57.057849 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Lys->Ala substitution |
K |
UNIMOD:1132 |
Lys->Cys |
-25.085779 |
Lys->Cys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1133 |
Lys->Asp |
-13.06802 |
Misacylation of the tRNA or editing of the charged tRNA, Lys->Asp substitution, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1134 |
Lys->Phe |
18.973451 |
Lys->Phe substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1135 |
Lys->Gly |
-71.073499 |
Misacylation of the tRNA or editing of the charged tRNA, Lys->Gly substitution, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1136 |
Lys->His |
8.963949 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Lys->His substitution, editing of the charged tRNA |
K |
UNIMOD:1137 |
Lys->Pro |
-31.042199 |
Misacylation of the tRNA or editing of the charged tRNA, Lys->Pro substitution, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1138 |
Lys->Ser |
-41.062935 |
Lys->Ser substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1139 |
Lys->Val |
-29.026549 |
Lys->Val substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1140 |
Lys->Trp |
57.98435 |
Lys->Trp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
K |
UNIMOD:1141 |
Lys->Tyr |
34.968366 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Lys->Tyr substitution, editing of the charged tRNA |
K |
UNIMOD:1142 |
Met->Ala |
-60.003371 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Met->Ala substitution, editing of the charged tRNA |
M |
UNIMOD:1143 |
Met->Cys |
-28.0313 |
Met->Cys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
M |
UNIMOD:1144 |
Met->Asp |
-16.013542 |
Misacylation of the tRNA or editing of the charged tRNA, Met->Asp substitution, Misacylation of the tRNA, editing of the charged tRNA |
M |
UNIMOD:1145 |
Met->Glu |
-1.997892 |
Met->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
M |
UNIMOD:1146 |
Met->Phe |
16.027929 |
Met->Phe substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
M |
UNIMOD:1147 |
Met->Gly |
-74.019021 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Met->Gly substitution, editing of the charged tRNA |
M |
UNIMOD:1148 |
Met->His |
6.018427 |
Misacylation of the tRNA or editing of the charged tRNA, Met->His substitution, Misacylation of the tRNA, editing of the charged tRNA |
M |
UNIMOD:1149 |
Met->Asn |
-16.997557 |
Met->Asn substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
M |
UNIMOD:1150 |
Met->Pro |
-33.987721 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Met->Pro substitution, editing of the charged tRNA |
M |
UNIMOD:1151 |
Met->Gln |
-2.981907 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Met->Gln substitution, editing of the charged tRNA |
M |
UNIMOD:1152 |
Met->Ser |
-44.008456 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Met->Ser substitution, editing of the charged tRNA |
M |
UNIMOD:1153 |
Met->Trp |
55.038828 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Met->Trp substitution, editing of the charged tRNA |
M |
UNIMOD:1154 |
Met->Tyr |
32.022844 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Met->Tyr substitution |
M |
UNIMOD:1155 |
Asn->Ala |
-43.005814 |
Asn->Ala substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
N |
UNIMOD:1156 |
Asn->Cys |
-11.033743 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asn->Cys substitution, editing of the charged tRNA |
N |
UNIMOD:1157 |
Asn->Glu |
14.999666 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asn->Glu substitution, editing of the charged tRNA |
N |
UNIMOD:1158 |
Asn->Phe |
33.025486 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asn->Phe substitution, editing of the charged tRNA |
N |
UNIMOD:1159 |
Asn->Gly |
-57.021464 |
Asn->Gly substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
N |
UNIMOD:1160 |
Asn->Met |
16.997557 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asn->Met substitution, editing of the charged tRNA |
N |
UNIMOD:1161 |
Asn->Pro |
-16.990164 |
Asn->Pro substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
N |
UNIMOD:1162 |
Asn->Gln |
14.01565 |
Asn->Gln substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
N |
UNIMOD:1163 |
Asn->Arg |
42.058184 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asn->Arg substitution, editing of the charged tRNA |
N |
UNIMOD:1164 |
Asn->Val |
-14.974514 |
Asn->Val substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
N |
UNIMOD:1165 |
Asn->Trp |
72.036386 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Asn->Trp substitution, editing of the charged tRNA |
N |
UNIMOD:1166 |
Pro->Cys |
5.956421 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Pro->Cys substitution, editing of the charged tRNA |
P |
UNIMOD:1167 |
Pro->Asp |
17.974179 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Pro->Asp substitution, editing of the charged tRNA |
P |
UNIMOD:1168 |
Pro->Glu |
31.989829 |
Pro->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
P |
UNIMOD:1169 |
Pro->Phe |
50.01565 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Pro->Phe substitution, editing of the charged tRNA |
P |
UNIMOD:1170 |
Pro->Gly |
-40.0313 |
Pro->Gly substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
P |
UNIMOD:1171 |
Pro->Lys |
31.042199 |
Pro->Lys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
P |
UNIMOD:1172 |
Pro->Met |
33.987721 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Pro->Met substitution, editing of the charged tRNA |
P |
UNIMOD:1173 |
Pro->Asn |
16.990164 |
Pro->Asn substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
P |
UNIMOD:1174 |
Pro->Val |
2.01565 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Pro->Val substitution, editing of the charged tRNA |
P |
UNIMOD:1175 |
Pro->Trp |
89.026549 |
Pro->Trp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
P |
UNIMOD:1176 |
Pro->Tyr |
66.010565 |
Pro->Tyr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
P |
UNIMOD:1177 |
Gln->Ala |
-57.021464 |
Gln->Ala substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1178 |
Gln->Cys |
-25.049393 |
Misacylation of the tRNA or editing of the charged tRNA, Gln->Cys substitution, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1179 |
Gln->Asp |
-13.031634 |
Gln->Asp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1180 |
Gln->Phe |
19.009836 |
Misacylation of the tRNA or editing of the charged tRNA, Gln->Phe substitution, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1181 |
Gln->Gly |
-71.037114 |
Gln->Gly substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1182 |
Gln->Met |
2.981907 |
Misacylation of the tRNA or editing of the charged tRNA, Gln->Met substitution, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1183 |
Gln->Asn |
-14.01565 |
Gln->Asn substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1184 |
Gln->Ser |
-41.026549 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Gln->Ser substitution, editing of the charged tRNA |
Q |
UNIMOD:1185 |
Gln->Thr |
-27.010899 |
Gln->Thr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1186 |
Gln->Val |
-28.990164 |
Gln->Val substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1187 |
Gln->Trp |
58.020735 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Gln->Trp substitution, editing of the charged tRNA |
Q |
UNIMOD:1188 |
Gln->Tyr |
35.004751 |
Gln->Tyr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Q |
UNIMOD:1189 |
Arg->Ala |
-85.063997 |
Arg->Ala substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
R |
UNIMOD:1190 |
Arg->Asp |
-41.074168 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Arg->Asp substitution, editing of the charged tRNA |
R |
UNIMOD:1191 |
Arg->Glu |
-27.058518 |
Arg->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
R |
UNIMOD:1192 |
Arg->Asn |
-42.058184 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Arg->Asn substitution |
R |
UNIMOD:1193 |
Arg->Val |
-57.032697 |
Misacylation of the tRNA or editing of the charged tRNA, Arg->Val substitution, Misacylation of the tRNA, editing of the charged tRNA |
R |
UNIMOD:1194 |
Arg->Tyr |
6.962218 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Arg->Tyr substitution, editing of the charged tRNA |
R |
UNIMOD:1195 |
Arg->Phe |
-9.032697 |
Misacylation of the tRNA or editing of the charged tRNA, Arg->Phe substitution, Misacylation of the tRNA, editing of the charged tRNA |
R |
UNIMOD:1196 |
Ser->Asp |
27.994915 |
Ser->Asp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
S |
UNIMOD:1197 |
Ser->Glu |
42.010565 |
Misacylation of the tRNA or editing of the charged tRNA, Ser->Glu substitution, Misacylation of the tRNA, editing of the charged tRNA |
S |
UNIMOD:1198 |
Ser->His |
50.026883 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Ser->His substitution |
S |
UNIMOD:1199 |
Ser->Lys |
41.062935 |
Ser->Lys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
S |
UNIMOD:1200 |
Ser->Met |
44.008456 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Ser->Met substitution, editing of the charged tRNA |
S |
UNIMOD:1201 |
Ser->Gln |
41.026549 |
Ser->Gln substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
S |
UNIMOD:1202 |
Ser->Val |
12.036386 |
Ser->Val substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
S |
UNIMOD:1203 |
Thr->Cys |
1.961506 |
Thr->Cys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1204 |
Thr->Asp |
13.979265 |
Thr->Asp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1205 |
Thr->Glu |
27.994915 |
Thr->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1206 |
Thr->Phe |
46.020735 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Thr->Phe substitution, editing of the charged tRNA |
T |
UNIMOD:1207 |
Thr->Gly |
-44.026215 |
Thr->Gly substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1208 |
Thr->His |
36.011233 |
Thr->His substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1209 |
Thr->Gln |
27.010899 |
Thr->Gln substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1210 |
Thr->Val |
-1.979265 |
Thr->Val substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1211 |
Thr->Trp |
85.031634 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Thr->Trp substitution, editing of the charged tRNA |
T |
UNIMOD:1212 |
Thr->Tyr |
62.01565 |
Thr->Tyr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
T |
UNIMOD:1213 |
Val->Cys |
3.940771 |
Val->Cys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1214 |
Val->His |
37.990498 |
Misacylation of the tRNA or editing of the charged tRNA, Val->His substitution, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1215 |
Val->Lys |
29.026549 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Val->Lys substitution, editing of the charged tRNA |
V |
UNIMOD:1216 |
Val->Asn |
14.974514 |
Val->Asn substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1217 |
Val->Pro |
-2.01565 |
Val->Pro substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1218 |
Val->Gln |
28.990164 |
Misacylation of the tRNA or editing of the charged tRNA, Val->Gln substitution, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1219 |
Val->Arg |
57.032697 |
Misacylation of the tRNA or editing of the charged tRNA, Val->Arg substitution, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1220 |
Val->Ser |
-12.036386 |
Val->Ser substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1221 |
Val->Thr |
1.979265 |
Val->Thr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1222 |
Val->Trp |
87.010899 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Val->Trp substitution, editing of the charged tRNA |
V |
UNIMOD:1223 |
Val->Tyr |
63.994915 |
Val->Tyr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
V |
UNIMOD:1224 |
Trp->Ala |
-115.042199 |
Trp->Ala substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1225 |
Trp->Asp |
-71.05237 |
Trp->Asp substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1226 |
Trp->Glu |
-57.03672 |
Trp->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1227 |
Trp->Phe |
-39.010899 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Trp->Phe substitution, editing of the charged tRNA |
W |
UNIMOD:1228 |
Trp->His |
-49.020401 |
Trp->His substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1229 |
Trp->Lys |
-57.98435 |
Trp->Lys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1230 |
Trp->Met |
-55.038828 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Trp->Met substitution, editing of the charged tRNA |
W |
UNIMOD:1231 |
Trp->Asn |
-72.036386 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Trp->Asn substitution, editing of the charged tRNA |
W |
UNIMOD:1232 |
Trp->Pro |
-89.026549 |
Trp->Pro substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1233 |
Trp->Gln |
-58.020735 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Trp->Gln substitution, editing of the charged tRNA |
W |
UNIMOD:1234 |
Trp->Thr |
-85.031634 |
Misacylation of the tRNA or editing of the charged tRNA, Trp->Thr substitution, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1235 |
Trp->Val |
-87.010899 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Trp->Val substitution, editing of the charged tRNA |
W |
UNIMOD:1236 |
Trp->Tyr |
-23.015984 |
Trp->Tyr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
W |
UNIMOD:1237 |
Tyr->Ala |
-92.026215 |
Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Tyr->Ala substitution, editing of the charged tRNA |
Y |
UNIMOD:1238 |
Tyr->Glu |
-34.020735 |
Tyr->Glu substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1239 |
Tyr->Gly |
-106.041865 |
Misacylation of the tRNA or editing of the charged tRNA, Tyr->Gly substitution, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1240 |
Tyr->Lys |
-34.968366 |
Tyr->Lys substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1241 |
Tyr->Met |
-32.022844 |
Misacylation of the tRNA or editing of the charged tRNA, Tyr->Met substitution, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1242 |
Tyr->Pro |
-66.010565 |
Tyr->Pro substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1243 |
Tyr->Gln |
-35.004751 |
Tyr->Gln substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1244 |
Tyr->Arg |
-6.962218 |
Tyr->Arg substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1245 |
Tyr->Thr |
-62.01565 |
Tyr->Thr substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1246 |
Tyr->Val |
-63.994915 |
Tyr->Val substitution, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, editing of the charged tRNA |
Y |
UNIMOD:1247 |
Tyr->Trp |
23.015984 |
editing of the charged tRNA, Misacylation of the tRNA or editing of the charged tRNA, Misacylation of the tRNA, Tyr->Trp substitution |
Y |
UNIMOD:1248 |
Tyr->Xle |
-49.979265 |
Tyr->Leu/Ile substitution |
Y |
UNIMOD:1249 |
AHA-SS |
195.075625 |
Azidohomoalanine coupled to reductively cleaved tag |
M |
UNIMOD:1250 |
AHA-SS_CAM |
252.097088 |
carbamidomethylated form of reductively cleaved tag coupled to azidohomoalanine |
M |
UNIMOD:1251 |
Biotin:Thermo-33033 |
548.223945 |
Sulfo-SBED Label Photoreactive Biotin Crosslinker |
|
UNIMOD:1252 |
Biotin:Thermo-33033-H |
546.208295 |
Sulfo-SBED Label Photoreactive Biotin Crosslinker minus Hydrogen |
|
UNIMOD:1253 |
2-monomethylsuccinyl |
130.026609 |
S-(2-monomethylsuccinyl) cysteine |
C |
UNIMOD:1254 |
o-toluene |
106.041865 |
Saligenin |
K, H |
UNIMOD:1255 |
Cresylphosphate |
170.013281 |
o-toluyl-phosphorylation |
H, K, S, T, R, Y |
UNIMOD:1256 |
CresylSaligeninPhosphate |
276.055146 |
Cresyl-Saligenin-phosphorylation |
H, K, S, T, R, Y |
UNIMOD:1257 |
Ub-Br2 |
100.063663 |
Ub Bromide probe addition, Active site DUB cystine modification with Br Ub probe, Trypsin Digestion reminant of Ub Br probe |
C |
UNIMOD:1258 |
Ub-VME |
172.084792 |
Ubiquitin vinylmethylester, Trypsin Digestion reminant of Ub VMEr probe, Active site DUB cystine modification with VME Ub probe |
C |
UNIMOD:1261 |
Ub-fluorescein |
597.209772 |
Active site DUB cystine modification with Fluorescein Ub probe, Ub Fluorescein probe addition, Trypsin Digestion reminant of Ub Fluorescein probe |
C |
UNIMOD:1262 |
2-dimethylsuccinyl |
144.042259 |
S-(2-dimethylsuccinyl) cysteine |
C |
UNIMOD:1263 |
Gly |
57.021464 |
Addition of Glycine |
S, K, T |
UNIMOD:1264 |
pupylation |
243.085521 |
addition of GGE |
K |
UNIMOD:1270 |
HCysThiolactone |
117.024835 |
N-Homocysteine thiolactone |
K |
UNIMOD:1271 |
HCysteinyl |
133.019749 |
S-homocysteinylation |
C |
UNIMOD:1276 |
UgiJoullie |
1106.48935 |
Side reaction of HisTag |
D, E |
UNIMOD:1277 |
Dipyridyl |
225.090212 |
Cys modified with dipy ligand |
C |
UNIMOD:1278 |
Furan |
66.010565 |
Chemical modification of the iodinated sites of thyroglobulin by Suzuki reaction |
Y |
UNIMOD:1279 |
Difuran |
132.021129 |
Chemical modification of the diiodinated sites of thyroglobulin by Suzuki reaction |
Y |
UNIMOD:1281 |
BMP-piperidinol |
263.131014 |
(4-hydroxy-1-methyl-4-phenylpiperidin-3-yl)(phenyl)methanone, 1-methyl-3-benzoyl-4-hydroxy-4-phenylpiperidine, 3-benzoyl-1-methyl-4-phenyl-4-piperidinol |
M, C |
UNIMOD:1282 |
glutamic acid |
154.074228 |
Side reaction of PG with Side chain of aspartic or glutamic acid, Side reaction of PG with Side chain of aspartic, UgiJoullieProGly |
D, E |
UNIMOD:1286 |
IMEHex(2)NeuAc(1) |
688.199683 |
Glycosylation with IME linked Hex(2) NeuAc, (2-Imino-2-methoxyethyl 1-thioglycoside) |
K |
UNIMOD:1287 |
Arg-loss |
-156.101111 |
Loss of arginine due to transpeptidation |
R @ C-term |
UNIMOD:1288 |
Arg |
156.101111 |
Addition of arginine due to transpeptidation |
N-term |
UNIMOD:1289 |
Butyryl |
70.041865 |
K |
|
UNIMOD:1290 |
Dicarbamidomethyl |
114.042927 |
Double Carbamidomethylation |
H, C, N-term, K, R |
UNIMOD:1291 |
Dimethyl:2H(6) |
34.068961 |
Dimethyl-Medium |
N-term, K, R |
UNIMOD:1292 |
GGQ |
242.101505 |
SUMOylation leaving GlyGlyGln |
K |
UNIMOD:1293 |
QTGG |
343.149184 |
SUMOylation leaving GlnThrGlyGly |
K |
UNIMOD:1296 |
Label:13C(3) |
3.010064 |
13C3 label for SILAC |
A |
UNIMOD:1298 |
Label:13C(4)15N(1) |
5.010454 |
13C4 15N1 label for SILAC |
D |
UNIMOD:1299 |
2H(10) label |
10.062767 |
Label:2H(10) |
L |
UNIMOD:1300 |
Label:2H(4)13C(1) |
5.028462 |
R |
|
UNIMOD:1301 |
Lys |
128.094963 |
Addition of lysine due to transpeptidation |
N-term |
UNIMOD:1302 |
mTRAQ heavy |
148.109162 |
Applied Biosystems mTRAQ(TM) reagent, mTRAQ:13C(6)15N(2) |
H, N-term, K, S, T, Y |
UNIMOD:1303 |
NeuAc |
291.095417 |
N-acetyl neuraminic acid |
S, N, T |
UNIMOD:1304 |
NeuGc |
307.090331 |
N-glycoyl neuraminic acid |
S, N, T |
UNIMOD:1305 |
Propyl |
42.04695 |
N-term, C-term, K, D, E |
|
UNIMOD:1306 |
Propyl:2H(6) |
48.084611 |
N-term, K |
|
UNIMOD:1310 |
Propiophenone |
132.057515 |
H, C, K, S, W, T, R |
|
UNIMOD:1312 |
Delta:H(6)C(3)O(1) |
58.041865 |
Reduced acrolein addition +58 |
N-term, K, H, C |
UNIMOD:1313 |
Delta:H(8)C(6)O(1) |
96.057515 |
Reduced acrolein addition +96 |
N-term, K |
UNIMOD:1314 |
biotinAcrolein298 |
298.146347 |
biotin hydrazide labeled acrolein addition +298 |
N-term, K, H, C |
UNIMOD:1315 |
MM-diphenylpentanone |
265.146664 |
3-methyl-5-(methylamino)-1,3-diphenylpentan-1-one |
C |
UNIMOD:1317 |
EHD-diphenylpentanone |
266.13068 |
3-benzoyl-1-methyl-4-phenyl-4-piperidinol demethyl damino, 2-ethyl-3-hydroxy-1,3-diphenylpentan-1-one |
M, C |
UNIMOD:1320 |
Biotin:Thermo-21901+2H2O |
561.246849 |
Maleimide-PEG2-Biotin + 2Water, Maleimide-Biotin + 2Water |
C |
UNIMOD:1321 |
DiLeu4plex115 |
145.12 |
Accurate mass for DiLeu 115 isobaric tag |
N-term, K, Y |
UNIMOD:1322 |
DiLeu4plex |
145.132163 |
Accurate mass for DiLeu 116 isobaric tag, Representative, nominal mass for all four tags |
N-term, K, Y |
UNIMOD:1323 |
DiLeu4plex117 |
145.128307 |
Accurate mass for DiLeu 117 isobaric tag |
N-term, K, Y |
UNIMOD:1324 |
DiLeu4plex118 |
145.140471 |
Accurate mass for DiLeu 118 isobaric tag |
N-term, K, Y |
UNIMOD:1326 |
NEMS |
157.019749 |
N-ethylmaleimideSulfur, NEMsulfur |
C |
UNIMOD:1327 |
SulfurDioxide |
63.9619 |
C |
|
UNIMOD:1328 |
NEMSwater |
175.030314 |
NEMsulfurWater, N-ethylmaleimideSulfurWater |
C |
UNIMOD:1330 |
bisANS-sulfonates |
434.178299 |
BisANS with loss of both sulfonates |
S, K, T |
UNIMOD:1331 |
DNCB_hapten |
166.001457 |
Chemical reaction with 2,4-dinitro-1-chloro benzene (DNCB) |
K, Y, H, C |
UNIMOD:1340 |
Thermo #21911 |
921.461652 |
Biotin-PEG11-maleimide, Biotin:Thermo-21911 |
C |
UNIMOD:1341 |
iodoTMT |
324.216141 |
iodoTMTzero, Native iodoacetyl Tandem Mass Tag®, iodoTMT0, Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc. |
H, C, K, D, E |
UNIMOD:1342 |
iodoTMT6 |
329.226595 |
iodoTMT6plex, Sixplex iodoacetyl Tandem Mass Tag®, Tandem Mass Tag® and TMT® are registered Trademarks of Proteome Sciences plc., iodoTMTsixplex |
H, C, K, D, E |
UNIMOD:1344 |
Phosphogluconoylation |
258.014069 |
N-term, K |
|
UNIMOD:1345 |
PS_Hapten |
120.021129 |
reaction with phenyl salicylate (PS) |
K, H, C |
UNIMOD:1348 |
Cy3-maleimide |
753.262796 |
Cy3 mono-functional maleimides are used for the selective labeling of molecules containing free sulfhydryl groups, such as cysteine residues in proteins and peptides and oligonucleotides., Cy3 Maleimide mono-Reactive dye |
C |
UNIMOD:1349 |
benzylguanidine |
132.068748 |
modification of the lysine side chain from NH2 to guanidine with a H removed in favor of a benzyl group, adds 132 Da to K side chain |
K |
UNIMOD:1350 |
CarboxymethylDMAP |
162.079313 |
A fixed +1 charge tag attached to the N-terminus of peptides, Added mass is reduced by 1 H to reflect that first charge state requires no proton addition, Replaces one of the N-terminal H atoms with C9H12N2O |
N-term |
UNIMOD:1355 |
azole |
-20.026215 |
Formation of five membered aromatic heterocycle |
S, C |
UNIMOD:1356 |
phosphoRibosyl |
212.00859 |
phosphate-ribosylation |
D, R, E |
UNIMOD:1358 |
NEM:2H(5)+H2O |
148.089627 |
CysNEM D5 hydrolised, D5 N-ethylmaleimide+water on cysteines |
C |
UNIMOD:1363 |
Crotonyl |
68.026215 |
Crotonylation |
K |
UNIMOD:1364 |
tabun |
135.044916 |
O-ethyl, N-dimethyl phosphate, O-Et-N-diMePhospho |
S |
UNIMOD:1365 |
aged tabun |
107.013615 |
N-dimethylphosphate |
S |
UNIMOD:1367 |
Hex1dHex1 |
308.110732 |
dHex(1)Hex(1) |
S, T |
UNIMOD:1368 |
Methyl:2H(3)+Acetyl:2H(3) |
62.063875 |
3-fold methylated lysine labelled with Acetyl_heavy |
K |
UNIMOD:1371 |
Trimethyl:2H(9) |
51.103441 |
3-fold methylation with deuterated methyl groups |
K, R |
UNIMOD:1372 |
Acetyl:13C(2) |
44.017274 |
heavy acetylation |
N-term, K |
UNIMOD:1375 |
Hex2dHex1 |
470.163556 |
dHex(1)Hex(2) |
S, T |
UNIMOD:1376 |
Hex3dHex1 |
632.216379 |
dHex(1)Hex(3) |
S, T |
UNIMOD:1377 |
Hex4dHex1 |
794.269203 |
dHex(1)Hex(4) |
S, T |
UNIMOD:1378 |
Hex5dHex1 |
956.322026 |
dHex(1)Hex(5) |
S, T |
UNIMOD:1379 |
Hex6dHex1 |
1118.37485 |
dHex(1)Hex(6) |
S, T |
UNIMOD:1380 |
methylsulfonylethyl |
106.00885 |
protein alkylation by Michael acceptor methyl vinyl sulfone, reaction with methyl vinyl sulfone |
K, H, C |
UNIMOD:1381 |
ethylsulfonylethyl |
120.0245 |
protein alkylation by Michael acceptor ethyl vinyl sulfone, reaction with ethyl vinyl sulfone |
K, H, C |
UNIMOD:1382 |
phenylsulfonylethyl |
168.0245 |
protein alkylation by Michael acceptor phenyl vinyl sulfone, reaction with phenyl vinyl sulfone |
C |
UNIMOD:1383 |
PyridoxalPhosphateH2 |
231.02966 |
PLP bound to lysine reduced by sodium borohydride (NaBH4) to create amine linkage, Pyridoxal Phosphate reduced |
K |
UNIMOD:1384 |
Homocysteic_acid |
33.969094 |
methionine oxidation to homocysteic acid |
M |
UNIMOD:1385 |
Hydroxamic_acid |
15.010899 |
Conversion of carboxylic acid to hydroxamic acid, ADP-ribosylation followed by conversion to hydroxamic acid via hydroxylamine |
D, E |
UNIMOD:1387 |
3-phosphoglyceryl |
167.982375 |
K |
|
UNIMOD:1388 |
HN2_mustard |
101.084064 |
Modification by hydroxylated mechloroethamine (HN-2) |
K, H, C |
UNIMOD:1389 |
HN3_mustard |
131.094629 |
Modification by hydroxylated tris-(2-chloroethyl)amine (HN-3) |
K, H, C |
UNIMOD:1390 |
Oxidation+NEM |
141.042593 |
N-ethylmaleimide on cysteine sulfenic acid |
C |
UNIMOD:1391 |
NHS-fluorescein |
471.131802 |
fluorescein-hexanoate-NHS hydrolysis |
K |
UNIMOD:1392 |
DiART6plex |
217.162932 |
AKA DiART6plex114, Isobaric labeling reagent from Omic Biosystems, Inc., Representative mass and accurate mass for 114 |
N-term, K, Y |
UNIMOD:1393 |
DiART6plex115 |
217.156612 |
Accurate mass for DiART6plex 115, Isobaric labeling reagent from Omic Biosystems, Inc. |
N-term, K, Y |
UNIMOD:1394 |
DiART6plex116/119 |
217.168776 |
Accurate mass for DiART6plex 116 and 119, Isobaric labeling reagent from Omic Biosystems, Inc. |
N-term, K, Y |
UNIMOD:1395 |
DiART6plex117 |
217.162456 |
Accurate mass for DiART6plex 117, Isobaric labeling reagent from Omic Biosystems, Inc. |
N-term, K, Y |
UNIMOD:1396 |
DiART6plex118 |
217.175096 |
Accurate mass for DiART6plex 118, Isobaric labeling reagent from Omic Biosystems, Inc. |
N-term, K, Y |
UNIMOD:1397 |
Iodoacetanilide |
133.052764 |
iodoacetanilide derivative |
N-term, K, C |
UNIMOD:1398 |
Iodoacetanilide:13C(6) |
139.072893 |
13C labelled iodoacetanilide derivative |
N-term, K, C |
UNIMOD:1399 |
Dap-DSP |
364.076278 |
Diaminopimelic acid-DSP monolinked |
K, E, A |
UNIMOD:1400 |
MurNAc |
275.100502 |
N-Acetylmuramic acid |
A |
UNIMOD:1402 |
Label:2H(7)15N(4) |
11.032077 |
Cambridge Isotopes DNLM-7543-PK |
R |
UNIMOD:1403 |
Label:2H(6)15N(1) |
7.034695 |
Arg-Pro conversion of Label:2H(7)15N(4) |
P |
UNIMOD:1405 |
EEEDVIEVYQEQTGG |
1705.73189 |
Sumoylation by SUMO-1 after Cyanogen bromide (CNBr) cleavage |
K |
UNIMOD:1406 |
EDEDTIDVFQQQTGG |
1662.700924 |
Sumoylation by SUMO-2/3 after Cyanogen bromide (CNBr) cleavage |
K |
UNIMOD:1408 |
A2G2S2/G2S2 |
2204.772441 |
Hex(5)HexNAc(4)NeuAc(2) |
N |
UNIMOD:1409 |
A2G2S1/G2S1 |
1913.677025 |
Hex(5)HexNAc(4)NeuAc(1) |
N |
UNIMOD:1410 |
FA2G2S1/G2FS1 |
2059.734933 |
dHex(1)Hex(5)HexNAc(4)NeuAc(1) |
N |
UNIMOD:1411 |
FA2G2S2/G2FS2 |
2350.83035 |
dHex(1)Hex(5)HexNAc(4)NeuAc(2) |
N |
UNIMOD:1412 |
s-GlcNAc |
283.036187 |
O3S1HexNAc1 |
S, T |
UNIMOD:1413 |
H1O3P1Hex2 |
404.071978 |
PhosphoHex(2) |
S, N, T |
UNIMOD:1414 |
Trimethyl:13C(3)2H(9) |
54.113505 |
3-fold methylation with fully labelled methyl groups |
K, R |
UNIMOD:1419 |
15N-oxobutanoic |
-18.023584 |
pyruvic acid from N-term ser, Loss of ammonia (15N), oxobutanoic acid from N term Thr |
S @ Protein N-term, T @ Protein N-term, C @ N-term |
UNIMOD:1420 |
spermine |
185.189198 |
spermine adduct |
Q |
UNIMOD:1421 |
spermidine |
128.131349 |
spermidine adduct |
Q |
UNIMOD:1423 |
Biotin_PEG4 |
473.219571 |
Biotin:Thermo-21330, NHS-PEG4-Biotin |
N-term, K |
UNIMOD:1425 |
Pentose |
132.042259 |
S, T |
|
UNIMOD:1426 |
Hex Pent |
294.095082 |
Hex(1)Pent(1) |
S, T |
UNIMOD:1427 |
Hex HexA |
338.084912 |
Hex(1)HexA(1) |
S, T |
UNIMOD:1428 |
Hex Pent(2) |
426.137341 |
Hex(1)Pent(2) |
S, T |
UNIMOD:1429 |
Hex HexNAc Phos |
445.098527 |
Hex(1)HexNAc(1)Phos(1) |
S, T |
UNIMOD:1430 |
Hex HexNAc Sulf |
445.089011 |
Hex(1)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1431 |
Hex(1)NeuAc(1) |
453.14824 |
Hex NeuAc —OR— HexNAc Kdn |
S, T |
UNIMOD:1432 |
Hex NeuGc |
469.143155 |
Hex(1)NeuGc(1) |
S, T |
UNIMOD:1433 |
HexNAc(3) |
609.238118 |
S, T |
|
UNIMOD:1434 |
HexNAc NeuAc |
494.174789 |
HexNAc(1)NeuAc(1) |
S, T |
UNIMOD:1435 |
HexNAc NeuGc |
510.169704 |
HexNAc(1)NeuGc(1) |
S, T |
UNIMOD:1436 |
Hex HexNAc dHex Me |
525.205755 |
Hex(1)HexNAc(1)dHex(1)Me(1) |
S, T |
UNIMOD:1437 |
Hex HexNAc dHex Me(2) |
539.221405 |
Hex(1)HexNAc(1)dHex(1)Me(2) |
S, T |
UNIMOD:1438 |
Hex(2) HexNAc |
527.18502 |
Hex(2)HexNAc(1) |
S, N, T |
UNIMOD:1439 |
Hex HexA HexNAc |
541.164284 |
Hex(1)HexA(1)HexNAc(1) |
S, T |
UNIMOD:1440 |
Hex(2) HexNAc Me |
541.20067 |
Hex(2)HexNAc(1)Me(1) |
S, T |
UNIMOD:1441 |
Hex Pent(3) |
558.1796 |
Hex(1)Pent(3) |
S, T |
UNIMOD:1442 |
Hex NeuAc Pent |
585.190499 |
Hex(1)NeuAc(1)Pent(1) |
S, T |
UNIMOD:1443 |
Hex(2) HexNAc Sulf |
607.141834 |
Hex(2)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1444 |
Hex(2)NeuAc(1) |
615.201064 |
Hex(2) NeuAc —OR— Hex HexNAc Kdn |
S, T |
UNIMOD:1445 |
Hex2 dHex2 |
616.221465 |
dHex(2)Hex(2) |
S, T |
UNIMOD:1446 |
dHex Hex(2) HexA |
646.195644 |
dHex(1)Hex(2)HexA(1) |
S, T |
UNIMOD:1447 |
Hex HexNAc(2) Sulf |
648.168383 |
Hex(1)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1448 |
Hex(4) |
648.211294 |
S, T |
|
UNIMOD:1449 |
dHex Hex(2) HexNAc(2) Pent |
1008.36456 |
dHex(1)Hex(2)HexNAc(2)Pent(1) |
N |
UNIMOD:1450 |
Hex(2)HexNAc(2)NeuAc(1) |
1021.359809 |
Hex(2) HexNAc(2) NeuAc —OR— dHex Hex HexNAc(2) NeuGc |
S, N, T |
UNIMOD:1451 |
Hex(3) HexNAc(2) Pent |
1024.359475 |
Hex(3)HexNAc(2)Pent(1) |
N |
UNIMOD:1452 |
Hex(4)HexNAc(2) |
1054.370039 |
Hex(4) HexNAc(2) |
N |
UNIMOD:1453 |
dHex Hex(4) HexNAc Pent |
1129.390834 |
dHex(1)Hex(4)HexNAc(1)Pent(1) |
N |
UNIMOD:1454 |
dHex Hex(3) HexNAc(2) Pent |
1170.417383 |
dHex(1)Hex(3)HexNAc(2)Pent(1) |
N |
UNIMOD:1455 |
Hex(3) HexNAc(2) NeuAc |
1183.412632 |
Hex(3)HexNAc(2)NeuAc(1) |
N |
UNIMOD:1456 |
Hex(4) HexNAc(2) Pent |
1186.412298 |
Hex(4)HexNAc(2)Pent(1) |
N |
UNIMOD:1457 |
Hex(3) HexNAc(3) Pent |
1227.438847 |
Hex(3)HexNAc(3)Pent(1) |
N |
UNIMOD:1458 |
Hex(5) HexNAc(2) Phos |
1296.389194 |
Hex(5)HexNAc(2)Phos(1) |
N |
UNIMOD:1459 |
dHex Hex(4) HexNAc(2) Pent |
1332.470207 |
dHex(1)Hex(4)HexNAc(2)Pent(1) |
N |
UNIMOD:1460 |
Hex(7) HexNAc |
1337.449137 |
Hex(7)HexNAc(1) |
N |
UNIMOD:1461 |
Hex(4)HexNAc(2)NeuAc(1) |
1345.465456 |
Hex(4) HexNAc(2) NeuAc —OR— Hex(3) HexNAc(2) dHex NeuGc |
S, N, T |
UNIMOD:1462 |
dHex Hex(5) HexNAc(2) |
1362.480772 |
dHex(1)Hex(5)HexNAc(2) |
N |
UNIMOD:1463 |
dHex Hex(3) HexNAc(3) Pent |
1373.496756 |
dHex(1)Hex(3)HexNAc(3)Pent(1) |
N |
UNIMOD:1464 |
Hex(3) HexNAc(4) Sulf |
1378.432776 |
Hex(3)HexNAc(4)Sulf(1) |
N |
UNIMOD:1465 |
M6/Man6 |
1378.475686 |
Hex(6)HexNAc(2) |
N |
UNIMOD:1466 |
Hex(4) HexNAc(3) Pent |
1389.491671 |
Hex(4)HexNAc(3)Pent(1) |
N |
UNIMOD:1467 |
dHex Hex(4) HexNAc(3) |
1403.507321 |
dHex(1)Hex(4)HexNAc(3) |
N |
UNIMOD:1468 |
Hex(5)HexNAc(3) |
1419.502235 |
Hex(5) HexNAc(3) |
N |
UNIMOD:1469 |
Hex(3) HexNAc(4) Pent |
1430.51822 |
Hex(3)HexNAc(4)Pent(1) |
N |
UNIMOD:1470 |
Hex(6) HexNAc(2) Phos |
1458.442017 |
Hex(6)HexNAc(2)Phos(1) |
N |
UNIMOD:1471 |
dHex Hex(4) HexNAc(3) Sulf |
1483.464135 |
dHex(1)Hex(4)HexNAc(3)Sulf(1) |
N |
UNIMOD:1472 |
dHex Hex(5) HexNAc(2) Pent |
1494.52303 |
dHex(1)Hex(5)HexNAc(2)Pent(1) |
N |
UNIMOD:1473 |
Hex(8) HexNAc |
1499.501961 |
Hex(8)HexNAc(1) |
N |
UNIMOD:1474 |
dHex(1)Hex(3)HexNAc(3)Pent(2) |
1505.539015 |
dHex Hex(3) HexNAc(3) Pent(2) |
N |
UNIMOD:1475 |
dHex(2)Hex(3)HexNAc(3)Pent(1) |
1519.554665 |
dHex(2) Hex(3) HexNAc(3) Pent |
N |
UNIMOD:1476 |
dHex Hex(3) HexNAc(4) Sulf |
1524.490684 |
dHex(1)Hex(3)HexNAc(4)Sulf(1) |
N |
UNIMOD:1477 |
dHex Hex(6) HexNAc(2) |
1524.533595 |
dHex(1)Hex(6)HexNAc(2) |
N |
UNIMOD:1478 |
dHex Hex(4) HexNAc(3) Pent |
1535.549579 |
dHex(1)Hex(4)HexNAc(3)Pent(1) |
N |
UNIMOD:1479 |
Hex(4) HexNAc(4) Sulf |
1540.485599 |
Hex(4)HexNAc(4)Sulf(1) |
N |
UNIMOD:1480 |
M7/Man7 |
1540.52851 |
Hex(7)HexNAc(2) |
N |
UNIMOD:1481 |
dHex(2)Hex(4)HexNAc(3) |
1549.56523 |
dHex(2) Hex(4) HexNAc(3) |
N |
UNIMOD:1482 |
Hex(5) HexNAc(3) Pent |
1551.544494 |
Hex(5)HexNAc(3)Pent(1) |
N |
UNIMOD:1483 |
Hex(4) HexNAc(3) NeuGc |
1564.539743 |
Hex(4)HexNAc(3)NeuGc(1) |
N |
UNIMOD:1484 |
dHex Hex(5) HexNAc(3) |
1565.560144 |
dHex(1)Hex(5)HexNAc(3) |
N |
UNIMOD:1485 |
dHex Hex(3) HexNAc(4) Pent |
1576.576129 |
dHex(1)Hex(3)HexNAc(4)Pent(1) |
N |
UNIMOD:1486 |
Hex(3) HexNAc(5) Sulf |
1581.512148 |
Hex(3)HexNAc(5)Sulf(1) |
N |
UNIMOD:1487 |
Hex(6)HexNAc(3) |
1581.555059 |
Hex(6) HexNAc(3) |
N |
UNIMOD:1488 |
Hex(3)HexNAc(4)NeuAc(1) |
1589.571378 |
Hex(3) HexNAc(4) NeuAc —OR— Hex(2) HexNAc(4) dHex NeuGc |
N |
UNIMOD:1489 |
Hex(4) HexNAc(4) Pent |
1592.571043 |
Hex(4)HexNAc(4)Pent(1) |
N |
UNIMOD:1490 |
Hex(7) HexNAc(2) Phos |
1620.494841 |
Hex(7)HexNAc(2)Phos(1) |
N |
UNIMOD:1491 |
Hex(4) HexNAc(4) Me(2) Pent |
1620.602343 |
Hex(4)HexNAc(4)Me(2)Pent(1) |
N |
UNIMOD:1492 |
dHex(1)Hex(3)HexNAc(3)Pent(3) |
1637.581274 |
dHex Hex(3) HexNAc(3) Pent(3) —OR— Hex(4) HexNAc(2) dHex(2) NeuAc |
N |
UNIMOD:1493 |
dHex Hex(5) HexNAc(3) Sulf |
1645.516959 |
dHex(1)Hex(5)HexNAc(3)Sulf(1) |
N |
UNIMOD:1494 |
dHex(2)Hex(3)HexNAc(3)Pent(2) |
1651.596924 |
dHex(2) Hex(3) HexNAc(3) Pent(2) |
N |
UNIMOD:1495 |
Hex(6) HexNAc(3) Phos |
1661.52139 |
Hex(6)HexNAc(3)Phos(1) |
N |
UNIMOD:1496 |
Hex(4)HexNAc(5) |
1663.608157 |
Hex(4) HexNAc(5) |
N |
UNIMOD:1497 |
dHex(3)Hex(3)HexNAc(3)Pent(1) |
1665.612574 |
dHex(3) Hex(3) HexNAc(3) Pent |
N |
UNIMOD:1498 |
dHex(2)Hex(4)HexNAc(3)Pent(1) |
1681.607488 |
dHex(2) Hex(4) HexNAc(3) Pent |
N |
UNIMOD:1499 |
dHex Hex(4) HexNAc(4) Sulf |
1686.543508 |
dHex(1)Hex(4)HexNAc(4)Sulf(1) |
N |
UNIMOD:1500 |
dHex Hex(7) HexNAc(2) |
1686.586419 |
dHex(1)Hex(7)HexNAc(2) |
N |
UNIMOD:1501 |
dHex(1)Hex(4)HexNAc(3)NeuAc(1) |
1694.602737 |
dHex Hex(4) HexNAc(3) NeuAc —OR— dHex(2) Hex(3) HexNAc(3) NeuGc |
S, N, T |
UNIMOD:1502 |
Hex(7)HexNAc(2)Phos(2) |
1700.461172 |
Hex(7) HexNAc(2) Phos(2) |
N |
UNIMOD:1503 |
Hex(5) HexNAc(4) Sulf |
1702.538423 |
Hex(5)HexNAc(4)Sulf(1) |
N |
UNIMOD:1504 |
M8/Man8 |
1702.581333 |
Hex(8)HexNAc(2) |
N |
UNIMOD:1505 |
dHex(1)Hex(3)HexNAc(4)Pent(2) |
1708.618387 |
dHex Hex(3) HexNAc(4) Pent(2) |
N |
UNIMOD:1506 |
dHex(1)Hex(4)HexNAc(3)NeuGc(1) |
1710.597652 |
dHex Hex(4) HexNAc(3) NeuGc —OR— Hex(5) HexNAc(3) NeuAc |
N |
UNIMOD:1507 |
dHex(2)Hex(3)HexNAc(4)Pent(1) |
1722.634037 |
dHex(2) Hex(3) HexNAc(4) Pent |
N |
UNIMOD:1508 |
dHex Hex(3) HexNAc(5) Sulf |
1727.570057 |
dHex(1)Hex(3)HexNAc(5)Sulf(1) |
N |
UNIMOD:1509 |
dHex Hex(6) HexNAc(3) |
1727.612968 |
dHex(1)Hex(6)HexNAc(3) |
N |
UNIMOD:1510 |
dHex Hex(3) HexNAc(4) NeuAc |
1735.629286 |
dHex(1)Hex(3)HexNAc(4)NeuAc(1) |
N |
UNIMOD:1511 |
dHex(3)Hex(3)HexNAc(4) |
1736.649688 |
dHex(3) Hex(3) HexNAc(4) |
N |
UNIMOD:1512 |
dHex Hex(4) HexNAc(4) Pent |
1738.628952 |
dHex(1)Hex(4)HexNAc(4)Pent(1) |
N |
UNIMOD:1513 |
Hex(4) HexNAc(5) Sulf |
1743.564972 |
Hex(4)HexNAc(5)Sulf(1) |
N |
UNIMOD:1514 |
Hex(7)HexNAc(3) |
1743.607882 |
Hex(7) HexNAc(3) |
N |
UNIMOD:1515 |
dHex Hex(4) HexNAc(3) NeuAc Sulf |
1774.559552 |
dHex(1)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) |
N |
UNIMOD:1516 |
Hex(5) HexNAc(4) Me(2) Pent |
1782.655167 |
Hex(5)HexNAc(4)Me(2)Pent(1) |
N |
UNIMOD:1517 |
Hex(3) HexNAc(6) Sulf |
1784.591521 |
Hex(3)HexNAc(6)Sulf(1) |
N |
UNIMOD:1518 |
dHex Hex(6) HexNAc(3) Sulf |
1807.569782 |
dHex(1)Hex(6)HexNAc(3)Sulf(1) |
N |
UNIMOD:1519 |
dHex Hex(4) HexNAc(5) |
1809.666066 |
dHex(1)Hex(4)HexNAc(5) |
N |
UNIMOD:1520 |
dHex Hex(5) HexA HexNAc(3) Sulf |
1821.549047 |
dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(1) |
N |
UNIMOD:1521 |
Hex(7) HexNAc(3) Phos |
1823.574213 |
Hex(7)HexNAc(3)Phos(1) |
N |
UNIMOD:1522 |
Hex(6)HexNAc(4)Me(3) |
1826.681382 |
Hex(6) HexNAc(4) Me(3) |
N |
UNIMOD:1523 |
dHex(2) Hex(4) HexNAc(4) Sulf |
1832.601417 |
dHex(2)Hex(4)HexNAc(4)Sulf(1) |
N |
UNIMOD:1524 |
Hex(4)HexNAc(3)NeuAc(2) |
1839.640245 |
Hex(4) HexNAc(3) NeuAc(2) |
N |
UNIMOD:1525 |
dHex(1)Hex(3)HexNAc(4)Pent(3) |
1840.660646 |
dHex Hex(3) HexNAc(4) Pent(3) |
N |
UNIMOD:1526 |
dHex(2)Hex(5)HexNAc(3)Pent(1) |
1843.660312 |
dHex(2) Hex(5) HexNAc(3) Pent |
N |
UNIMOD:1527 |
dHex Hex(5) HexNAc(4) Sulf |
1848.596331 |
dHex(1)Hex(5)HexNAc(4)Sulf(1) |
N |
UNIMOD:1528 |
dHex(2)Hex(3)HexNAc(4)Pent(2) |
1854.676296 |
dHex(2) Hex(3) HexNAc(4) Pent(2) |
N |
UNIMOD:1529 |
dHex Hex(5) HexNAc(3) NeuAc |
1856.655561 |
dHex(1)Hex(5)HexNAc(3)NeuAc(1) |
N |
UNIMOD:1530 |
Hex(3)HexNAc(6)Sulf(2) |
1864.548335 |
Hex(3) HexNAc(6) Sulf(2) |
N |
UNIMOD:1531 |
M9/Man9 |
1864.634157 |
Hex(9)HexNAc(2) |
N |
UNIMOD:1532 |
Hex(4)HexNAc(6) |
1866.68753 |
Hex(4) HexNAc(6) |
N |
UNIMOD:1533 |
dHex(3)Hex(3)HexNAc(4)Pent(1) |
1868.691946 |
dHex(3) Hex(3) HexNAc(4) Pent |
N |
UNIMOD:1534 |
dHex(1)Hex(5)HexNAc(3)NeuGc(1) |
1872.650475 |
dHex Hex(5) HexNAc(3) NeuGc —OR— Hex(6) HexNAc(3) NeuAc |
N |
UNIMOD:1535 |
dHex(2) Hex(4) HexNAc(4) Pent |
1884.686861 |
dHex(2)Hex(4)HexNAc(4)Pent(1) |
N |
UNIMOD:1536 |
dHex Hex(4) HexNAc(5) Sulf |
1889.62288 |
dHex(1)Hex(4)HexNAc(5)Sulf(1) |
N |
UNIMOD:1537 |
dHex Hex(7) HexNAc(3) |
1889.665791 |
dHex(1)Hex(7)HexNAc(3) |
N |
UNIMOD:1538 |
dHex Hex(5) HexNAc(4) Pent |
1900.681776 |
dHex(1)Hex(5)HexNAc(4)Pent(1) |
N |
UNIMOD:1539 |
dHex Hex(5) HexA HexNAc(3) Sulf(2) |
1901.505861 |
dHex(1)Hex(5)HexA(1)HexNAc(3)Sulf(2) |
N |
UNIMOD:1540 |
Hex(3)HexNAc(7) |
1907.714079 |
Hex(3) HexNAc(7) |
N |
UNIMOD:1541 |
dHex(2)Hex(5)HexNAc(4) |
1914.697426 |
dHex(2) Hex(5) HexNAc(4) |
N |
UNIMOD:1542 |
dHex(2) Hex(4) HexNAc(3) NeuAc Sulf |
1920.617461 |
dHex(2)Hex(4)HexNAc(3)NeuAc(1)Sulf(1) |
N |
UNIMOD:1543 |
dHex(1)Hex(5)HexNAc(4)Sulf(2) |
1928.553146 |
dHex Hex(5) HexNAc(4) Sulf(2) |
N |
UNIMOD:1544 |
dHex Hex(5) HexNAc(4) Me(2) Pent |
1928.713076 |
dHex(1)Hex(5)HexNAc(4)Me(2)Pent(1) |
N |
UNIMOD:1545 |
Hex(5) HexNAc(4) NeuGc |
1929.671939 |
Hex(5)HexNAc(4)NeuGc(1) |
N |
UNIMOD:1546 |
dHex Hex(3) HexNAc(6) Sulf |
1930.64943 |
dHex(1)Hex(3)HexNAc(6)Sulf(1) |
N |
UNIMOD:1547 |
dHex Hex(6) HexNAc(4) |
1930.69234 |
dHex(1)Hex(6)HexNAc(4) |
N |
UNIMOD:1548 |
dHex Hex(5) HexNAc(3) NeuAc Sulf |
1936.612375 |
dHex(1)Hex(5)HexNAc(3)NeuAc(1)Sulf(1) |
N |
UNIMOD:1549 |
Hex(7)HexNAc(4) |
1946.687255 |
Hex(7) HexNAc(4) |
N |
UNIMOD:1550 |
dHex Hex(5) HexNAc(3) NeuGc Sulf |
1952.60729 |
dHex(1)Hex(5)HexNAc(3)NeuGc(1)Sulf(1) |
N |
UNIMOD:1551 |
Hex(4) HexNAc(5) NeuAc |
1954.703574 |
Hex(4)HexNAc(5)NeuAc(1) |
N |
UNIMOD:1552 |
Hex(6) HexNAc(4) Me(3) Pent |
1958.72364 |
Hex(6)HexNAc(4)Me(3)Pent(1) |
N |
UNIMOD:1553 |
dHex Hex(7) HexNAc(3) Sulf |
1969.622606 |
dHex(1)Hex(7)HexNAc(3)Sulf(1) |
N |
UNIMOD:1554 |
dHex Hex(7) HexNAc(3) Phos |
1969.632122 |
dHex(1)Hex(7)HexNAc(3)Phos(1) |
N |
UNIMOD:1555 |
dHex Hex(5) HexNAc(5) |
1971.718889 |
dHex(1)Hex(5)HexNAc(5) |
N |
UNIMOD:1556 |
dHex Hex(4) HexNAc(4) NeuAc Sulf |
1977.638925 |
dHex(1)Hex(4)HexNAc(4)NeuAc(1)Sulf(1) |
N |
UNIMOD:1557 |
dHex(3)Hex(4)HexNAc(4)Sulf(1) |
1978.659326 |
dHex(3) Hex(4) HexNAc(4) Sulf |
N |
UNIMOD:1558 |
Hex(3) HexNAc(7) Sulf |
1987.670893 |
Hex(3)HexNAc(7)Sulf(1) |
N |
UNIMOD:1559 |
A3G3 |
1987.713804 |
Hex(6)HexNAc(5) |
N |
UNIMOD:1560 |
Hex(5) HexNAc(4) NeuAc Sulf |
1993.633839 |
Hex(5)HexNAc(4)NeuAc(1)Sulf(1) |
N |
UNIMOD:1561 |
Hex(3) HexNAc(6) NeuAc |
1995.730123 |
Hex(3)HexNAc(6)NeuAc(1) |
N |
UNIMOD:1562 |
dHex(2)Hex(3)HexNAc(6) |
1996.750524 |
dHex(2) Hex(3) HexNAc(6) |
N |
UNIMOD:1563 |
Hex HexNAc NeuGc |
672.222527 |
Hex(1)HexNAc(1)NeuGc(1) |
S, T |
UNIMOD:1564 |
dHex Hex(2) HexNAc |
673.242928 |
dHex(1)Hex(2)HexNAc(1) |
S, T |
UNIMOD:1565 |
HexNAc(3) Sulf |
689.194932 |
HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1566 |
Hex(3) HexNAc |
689.237843 |
Hex(3)HexNAc(1) |
S, N, T |
UNIMOD:1567 |
Hex HexNAc Kdn Sulf |
695.157878 |
Hex(1)HexNAc(1)Kdn(1)Sulf(1) |
S, T |
UNIMOD:1568 |
HexNAc(2) NeuAc |
697.254162 |
HexNAc(2)NeuAc(1) |
S, T |
UNIMOD:1570 |
HexNAc(1)Kdn(2) |
703.217108 |
HexNAc Kdn(2) —OR— Hex(2) HexNAc HexA |
S, T |
UNIMOD:1571 |
Hex(3) HexNAc Me |
703.253493 |
Hex(3)HexNAc(1)Me(1) |
S, T |
UNIMOD:1572 |
Hex(2) HexA Pent Sulf |
712.136808 |
Hex(2)HexA(1)Pent(1)Sulf(1) |
S, T |
UNIMOD:1573 |
HexNAc(2) NeuGc |
713.249076 |
HexNAc(2)NeuGc(1) |
S, T |
UNIMOD:1575 |
Hex(4) Phos |
728.177625 |
Hex(4)Phos(1) |
S, T |
UNIMOD:1577 |
Hex HexNAc NeuAc Sulf |
736.184427 |
Hex(1)HexNAc(1)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1578 |
Hex HexA HexNAc(2) |
744.243657 |
Hex(1)HexA(1)HexNAc(2) |
S, T |
UNIMOD:1579 |
dHex Hex(2) HexNAc Sulf |
753.199743 |
dHex(1)Hex(2)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1580 |
dHex HexNAc(3) |
755.296027 |
dHex(1)HexNAc(3) |
S, T |
UNIMOD:1581 |
dHex(1)Hex(1)HexNAc(1)Kdn(1) |
761.258973 |
dHex Hex HexNAc Kdn —OR— Hex(2) dHex NeuAc |
S, T |
UNIMOD:1582 |
Hex HexNAc(3) |
771.290941 |
Hex(1)HexNAc(3) |
S, T |
UNIMOD:1583 |
HexNAc(2) NeuAc Sulf |
777.210976 |
HexNAc(2)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1584 |
dHex(2)Hex(3) |
778.274288 |
dHex(2) Hex(3) |
S, T |
UNIMOD:1585 |
Hex(2) HexA HexNAc Sulf |
783.173922 |
Hex(2)HexA(1)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1586 |
dHex(2) Hex(2) HexA |
792.253553 |
dHex(2)Hex(2)HexA(1) |
S, T |
UNIMOD:1587 |
dHex Hex HexNAc(2) Sulf |
794.226292 |
dHex(1)Hex(1)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1588 |
dHex Hex HexNAc NeuAc |
802.285522 |
dHex(1)Hex(1)HexNAc(1)NeuAc(1) |
S, T |
UNIMOD:1589 |
Hex(2) HexNAc(2) Sulf |
810.221207 |
Hex(2)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1590 |
Hex(5) |
810.264117 |
S, T |
|
UNIMOD:1591 |
HexNAc(4) |
812.31749 |
S, T |
|
UNIMOD:1592 |
HexNAc NeuGc(2) |
817.260035 |
HexNAc(1)NeuGc(2) |
S, T |
UNIMOD:1593 |
dHex(1)Hex(1)HexNAc(1)NeuGc(1) |
818.280436 |
dHex Hex HexNAc NeuGc —OR— Hex(2) HexNAc NeuAc |
S, T |
UNIMOD:1594 |
dHex(2) Hex(2) HexNAc |
819.300837 |
dHex(2)Hex(2)HexNAc(1) |
S, T |
UNIMOD:1595 |
Hex(2) HexNAc NeuGc |
834.275351 |
Hex(2)HexNAc(1)NeuGc(1) |
S, T |
UNIMOD:1596 |
dHex Hex(3) HexNAc |
835.295752 |
dHex(1)Hex(3)HexNAc(1) |
S, T |
UNIMOD:1597 |
dHex Hex(2) HexA HexNAc |
849.275017 |
dHex(1)Hex(2)HexA(1)HexNAc(1) |
S, T |
UNIMOD:1598 |
Hex HexNAc(3) Sulf |
851.247756 |
Hex(1)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1599 |
Hex(4) HexNAc |
851.290667 |
Hex(4)HexNAc(1) |
S, N, T |
UNIMOD:1600 |
Hex HexNAc(2) NeuAc |
859.306985 |
Hex(1)HexNAc(2)NeuAc(1) |
S, T |
UNIMOD:1602 |
Hex HexNAc(2) NeuGc |
875.3019 |
Hex(1)HexNAc(2)NeuGc(1) |
S, T |
UNIMOD:1604 |
Hex(5) Phos |
890.230448 |
Hex(5)Phos(1) |
S, T |
UNIMOD:1606 |
dHex(2) Hex HexNAc Kdn |
907.316881 |
dHex(2)Hex(1)HexNAc(1)Kdn(1) |
S, T |
UNIMOD:1607 |
dHex Hex(3) HexNAc Sulf |
915.252567 |
dHex(1)Hex(3)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1608 |
dHex Hex HexNAc(3) |
917.34885 |
dHex(1)Hex(1)HexNAc(3) |
S, T |
UNIMOD:1609 |
dHex Hex(2) HexA HexNAc Sulf |
929.231831 |
dHex(1)Hex(2)HexA(1)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1610 |
Hex(2)HexNAc(3) |
933.343765 |
Hex(2) HexNAc(3) |
S, N, T |
UNIMOD:1611 |
Hex HexNAc(2) NeuAc Sulf |
939.2638 |
Hex(1)HexNAc(2)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1612 |
dHex(2)Hex(4) |
940.327112 |
dHex(2) Hex(4) |
S, T |
UNIMOD:1614 |
dHex(2) HexNAc(2) Kdn |
948.34343 |
dHex(2)HexNAc(2)Kdn(1) |
S, T |
UNIMOD:1615 |
dHex Hex(2) HexNAc(2) Sulf |
956.279116 |
dHex(1)Hex(2)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1616 |
dHex HexNAc(4) |
958.375399 |
dHex(1)HexNAc(4) |
S, T |
UNIMOD:1617 |
Hex HexNAc NeuAc NeuGc |
963.317944 |
Hex(1)HexNAc(1)NeuAc(1)NeuGc(1) |
S, T |
UNIMOD:1618 |
dHex(1)Hex(1)HexNAc(2)Kdn(1) |
964.338345 |
dHex Hex HexNAc(2) Kdn —OR— Hex(2) HexNAc dHex NeuAc |
S, T |
UNIMOD:1619 |
Hex HexNAc NeuGc(2) |
979.312859 |
Hex(1)HexNAc(1)NeuGc(2) |
S, T |
UNIMOD:1620 |
Ac Hex HexNAc NeuAc(2) |
989.333594 |
Hex(1)HexNAc(1)NeuAc(2)Ac(1) |
S, T |
UNIMOD:1621 |
dHex(2) Hex(2) HexA HexNAc |
995.332925 |
dHex(2)Hex(2)HexA(1)HexNAc(1) |
S, T |
UNIMOD:1622 |
dHex Hex HexNAc(3) Sulf |
997.305665 |
dHex(1)Hex(1)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1623 |
Hex(2) HexA NeuAc Pent Sulf |
1003.232225 |
Hex(2)HexA(1)NeuAc(1)Pent(1)Sulf(1) |
S, T |
UNIMOD:1624 |
dHex Hex HexNAc(2) NeuAc |
1005.364894 |
dHex(1)Hex(1)HexNAc(2)NeuAc(1) |
S, T |
UNIMOD:1625 |
dHex Hex(3) HexA HexNAc |
1011.32784 |
dHex(1)Hex(3)HexA(1)HexNAc(1) |
S, T |
UNIMOD:1626 |
Hex(2) HexNAc(3) Sulf |
1013.300579 |
Hex(2)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1627 |
Hex(5) HexNAc |
1013.34349 |
Hex(5)HexNAc(1) |
S, N, T |
UNIMOD:1628 |
HexNAc(5) |
1015.396863 |
S, T |
|
UNIMOD:1630 |
Ac(2) Hex HexNAc NeuAc(2) |
1031.344159 |
Hex(1)HexNAc(1)NeuAc(2)Ac(2) |
S, T |
UNIMOD:1631 |
Hex(2) HexNAc(2) NeuGc |
1037.354723 |
Hex(2)HexNAc(2)NeuGc(1) |
S, T |
UNIMOD:1632 |
Hex(5)Phos(3) |
1050.16311 |
Hex(5) Phos(3) |
S, T |
UNIMOD:1633 |
Hex(6) Phos |
1052.283272 |
Hex(6)Phos(1) |
S, T |
UNIMOD:1634 |
dHex Hex(2) HexA HexNAc(2) |
1052.354389 |
dHex(1)Hex(2)HexA(1)HexNAc(2) |
S, T |
UNIMOD:1635 |
dHex(2) Hex(3) HexNAc Sulf |
1061.310475 |
dHex(2)Hex(3)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1636 |
Hex HexNAc(3) NeuAc |
1062.386358 |
Hex(1)HexNAc(3)NeuAc(1) |
S, T |
UNIMOD:1637 |
dHex(2) Hex HexNAc(3) |
1063.406759 |
dHex(2)Hex(1)HexNAc(3) |
S, T |
UNIMOD:1638 |
Hex HexNAc(3) NeuGc |
1078.381273 |
Hex(1)HexNAc(3)NeuGc(1) |
S, T |
UNIMOD:1639 |
dHex Hex HexNAc(2) NeuAc Sulf |
1085.321709 |
dHex(1)Hex(1)HexNAc(2)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1640 |
dHex Hex(3) HexA HexNAc Sulf |
1091.284655 |
dHex(1)Hex(3)HexA(1)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1641 |
dHex Hex HexA HexNAc(3) |
1093.380938 |
dHex(1)Hex(1)HexA(1)HexNAc(3) |
S, T |
UNIMOD:1642 |
Hex(2) HexNAc(2) NeuAc Sulf |
1101.316623 |
Hex(2)HexNAc(2)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1643 |
dHex(2) Hex(2) HexNAc(2) Sulf |
1102.337025 |
dHex(2)Hex(2)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1644 |
dHex(2)Hex(1)HexNAc(2)Kdn(1) |
1110.396254 |
dHex(2) Hex HexNAc(2) Kdn —OR— Hex(2) HexNAc dHex(2) NeuAc |
S, T |
UNIMOD:1645 |
dHex Hex HexNAc(4) |
1120.428223 |
dHex(1)Hex(1)HexNAc(4) |
S, T |
UNIMOD:1646 |
Hex(2)HexNAc(4) |
1136.423137 |
Hex(2) HexNAc(4) |
S, N, T |
UNIMOD:1647 |
Hex(2) HexNAc NeuGc(2) |
1141.365682 |
Hex(2)HexNAc(1)NeuGc(2) |
S, T |
UNIMOD:1648 |
dHex(2) Hex(4) HexNAc |
1143.406484 |
dHex(2)Hex(4)HexNAc(1) |
S, T |
UNIMOD:1649 |
Hex HexNAc(2) NeuAc(2) |
1150.402402 |
Hex(1)HexNAc(2)NeuAc(2) |
S, T |
UNIMOD:1650 |
dHex(2) Hex HexNAc(2) NeuAc |
1151.422803 |
dHex(2)Hex(1)HexNAc(2)NeuAc(1) |
S, T |
UNIMOD:1651 |
dHex Hex(2) HexNAc(3) Sulf |
1159.358488 |
dHex(1)Hex(2)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1652 |
dHex HexNAc(5) |
1161.454772 |
dHex(1)HexNAc(5) |
S, T |
UNIMOD:1653 |
dHex(2)Hex(1)HexNAc(2)NeuGc(1) |
1167.417718 |
dHex(2) Hex HexNAc(2) NeuGc —OR— Hex(2) HexNAc(2) dHex NeuAc —OR— Hex HexNAc(3) dHex Kdn |
S, T |
UNIMOD:1654 |
dHex(3)Hex(2)HexNAc(2) |
1168.438119 |
dHex(3) Hex(2) HexNAc(2) |
S, T |
UNIMOD:1655 |
Hex(3) HexNAc(3) Sulf |
1175.353403 |
Hex(3)HexNAc(3)Sulf(1) |
S, N, T |
UNIMOD:1656 |
dHex(2)Hex(2)HexNAc(2)Sulf(2) |
1182.293839 |
dHex(2) Hex(2) HexNAc(2) Sulf(2) |
S, T |
UNIMOD:1657 |
dHex(1)Hex(2)HexNAc(2)NeuGc(1) |
1183.412632 |
dHex Hex(2) HexNAc(2) NeuGc —OR— Hex(3) HexNAc(2) NeuAc |
S, N, T |
UNIMOD:1658 |
dHex Hex HexNAc(3) NeuAc |
1208.444267 |
dHex(1)Hex(1)HexNAc(3)NeuAc(1) |
S, T |
UNIMOD:1659 |
Hex(6)Phos(3) |
1212.215934 |
Hex(6) Phos(3) |
S, T |
UNIMOD:1660 |
dHex Hex(3) HexA HexNAc(2) |
1214.407213 |
dHex(1)Hex(3)HexA(1)HexNAc(2) |
S, T |
UNIMOD:1661 |
dHex(1)Hex(1)HexNAc(3)NeuGc(1) |
1224.439181 |
dHex Hex HexNAc(3) NeuGc —OR— Hex(2) HexNAc(3) NeuAc |
S, T |
UNIMOD:1662 |
Hex HexNAc(2) NeuAc(2) Sulf |
1230.359217 |
Hex(1)HexNAc(2)NeuAc(2)Sulf(1) |
S, T |
UNIMOD:1663 |
dHex(2) Hex(3) HexA HexNAc Sulf |
1237.342563 |
dHex(2)Hex(3)HexA(1)HexNAc(1)Sulf(1) |
S, T |
UNIMOD:1664 |
Hex HexNAc NeuAc(3) |
1238.418446 |
Hex(1)HexNAc(1)NeuAc(3) |
S, T |
UNIMOD:1665 |
Hex(2) HexNAc(3) NeuGc |
1240.434096 |
Hex(2)HexNAc(3)NeuGc(1) |
S, T |
UNIMOD:1666 |
dHex Hex(2) HexNAc(2) NeuAc Sulf |
1247.374532 |
dHex(1)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1667 |
dHex(3) Hex HexNAc(2) Kdn |
1256.454163 |
dHex(3)Hex(1)HexNAc(2)Kdn(1) |
S, T |
UNIMOD:1668 |
dHex(2) Hex(3) HexNAc(2) Sulf |
1264.389848 |
dHex(2)Hex(3)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1669 |
dHex(2)Hex(2)HexNAc(2)Kdn(1) |
1272.449077 |
dHex(2) Hex(2) HexNAc(2) Kdn |
S, T |
UNIMOD:1670 |
dHex(2) Hex(2) HexA HexNAc(2) Sulf |
1278.369113 |
dHex(2)Hex(2)HexA(1)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1671 |
dHex Hex(2) HexNAc(4) |
1282.481046 |
dHex(1)Hex(2)HexNAc(4) |
S, N, T |
UNIMOD:1672 |
Hex HexNAc NeuGc(3) |
1286.40319 |
Hex(1)HexNAc(1)NeuGc(3) |
S, T |
UNIMOD:1673 |
dHex Hex HexNAc(3) NeuAc Sulf |
1288.401081 |
dHex(1)Hex(1)HexNAc(3)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1674 |
dHex Hex(3) HexA HexNAc(2) Sulf |
1294.364027 |
dHex(1)Hex(3)HexA(1)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1675 |
dHex Hex HexNAc(2) NeuAc(2) |
1296.460311 |
dHex(1)Hex(1)HexNAc(2)NeuAc(2) |
S, T |
UNIMOD:1676 |
dHex(3) HexNAc(3) Kdn |
1297.480712 |
dHex(3)HexNAc(3)Kdn(1) |
S, T |
UNIMOD:1678 |
Hex(2) HexNAc(3) NeuAc Sulf |
1304.395996 |
Hex(2)HexNAc(3)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1679 |
dHex(2)Hex(2)HexNAc(3)Sulf(1) |
1305.416397 |
dHex(2) Hex(2) HexNAc(3) Sulf |
S, T |
UNIMOD:1680 |
dHex(2)HexNAc(5) |
1307.512681 |
dHex(2) HexNAc(5) |
S, T |
UNIMOD:1681 |
Hex(2)HexNAc(2)NeuAc(2) |
1312.455225 |
Hex(2) HexNAc(2) NeuAc(2) |
S, T |
UNIMOD:1682 |
dHex(2)Hex(2)HexNAc(2)NeuAc(1) |
1313.475627 |
dHex(2) Hex(2) HexNAc(2) NeuAc —OR— Hex HexNAc(3) dHex(2) Kdn |
S, T |
UNIMOD:1683 |
dHex Hex(3) HexNAc(3) Sulf |
1321.411312 |
dHex(1)Hex(3)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1684 |
dHex(2)Hex(2)HexNAc(2)NeuGc(1) |
1329.470541 |
dHex(2) Hex(2) HexNAc(2) NeuGc —OR— Hex(3) HexNAc(2) dHex NeuAc —OR— Hex(2) HexNAc(3) dHex Kdn |
S, T |
UNIMOD:1685 |
Hex(2)HexNAc(5) |
1339.50251 |
Hex(2) HexNAc(5) |
S, T |
UNIMOD:1686 |
dHex Hex(3) HexNAc(2) NeuGc |
1345.465456 |
dHex(1)Hex(3)HexNAc(2)NeuGc(1) |
S, T |
UNIMOD:1687 |
Hex HexNAc(3) NeuAc(2) |
1353.481775 |
Hex(1)HexNAc(3)NeuAc(2) |
S, T |
UNIMOD:1688 |
dHex Hex(2) HexNAc(3) NeuAc |
1370.49709 |
dHex(1)Hex(2)HexNAc(3)NeuAc(1) |
S, T |
UNIMOD:1689 |
dHex(3)Hex(2)HexNAc(3) |
1371.517491 |
dHex(3) Hex(2) HexNAc(3) |
S, T |
UNIMOD:1690 |
Hex(7)Phos(3) |
1374.268757 |
Hex(7) Phos(3) |
S, T |
UNIMOD:1691 |
dHex Hex(4) HexA HexNAc(2) |
1376.460036 |
dHex(1)Hex(4)HexA(1)HexNAc(2) |
S, T |
UNIMOD:1692 |
Hex(3)HexNAc(3)NeuAc(1) |
1386.492005 |
Hex(3) HexNAc(3) NeuAc —OR— Hex(2) HexNAc(3) dHex NeuGc —OR— Hex(2) HexNAc(4) Kdn |
S, T |
UNIMOD:1693 |
dHex(1)Hex(3)HexA(2)HexNAc(2) |
1390.439301 |
dHex Hex(3) HexA(2) HexNAc(2) |
S, T |
UNIMOD:1694 |
Hex(2) HexNAc(2) NeuAc(2) Sulf |
1392.41204 |
Hex(2)HexNAc(2)NeuAc(2)Sulf(1) |
S, T |
UNIMOD:1695 |
dHex(2) Hex(2) HexNAc(2) NeuAc Sulf |
1393.432441 |
dHex(2)Hex(2)HexNAc(2)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1696 |
Hex(3) HexNAc(3) NeuGc |
1402.48692 |
Hex(3)HexNAc(3)NeuGc(1) |
S, T |
UNIMOD:1697 |
dHex(4) Hex HexNAc(2) Kdn |
1402.512072 |
dHex(4)Hex(1)HexNAc(2)Kdn(1) |
S, T |
UNIMOD:1698 |
dHex(3)Hex(2)HexNAc(2)Kdn(1) |
1418.506986 |
dHex(3) Hex(2) HexNAc(2) Kdn |
S, T |
UNIMOD:1699 |
dHex(3) Hex(2) HexA HexNAc(2) Sulf |
1424.427021 |
dHex(3)Hex(2)HexA(1)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1700 |
Hex(2) HexNAc(4) NeuAc |
1427.518554 |
Hex(2)HexNAc(4)NeuAc(1) |
S, T |
UNIMOD:1701 |
dHex(2)Hex(2)HexNAc(4) |
1428.538955 |
dHex(2) Hex(2) HexNAc(4) |
S, T |
UNIMOD:1702 |
dHex(2) Hex(3) HexA HexNAc(2) Sulf |
1440.421936 |
dHex(2)Hex(3)HexA(1)HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1703 |
dHex(4) HexNAc(3) Kdn |
1443.538621 |
dHex(4)HexNAc(3)Kdn(1) |
S, T |
UNIMOD:1705 |
Hex(2) HexNAc NeuGc(3) |
1448.456013 |
Hex(2)HexNAc(1)NeuGc(3) |
S, T |
UNIMOD:1706 |
dHex(4) Hex HexNAc Kdn(2) |
1449.501567 |
dHex(4)Hex(1)HexNAc(1)Kdn(2) |
S, T |
UNIMOD:1707 |
dHex Hex(2) HexNAc(3) NeuAc Sulf |
1450.453905 |
dHex(1)Hex(2)HexNAc(3)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1708 |
dHex Hex(2) HexNAc(2) NeuAc(2) |
1458.513134 |
dHex(1)Hex(2)HexNAc(2)NeuAc(2) |
S, T |
UNIMOD:1709 |
dHex(3) Hex HexNAc(3) Kdn |
1459.533535 |
dHex(3)Hex(1)HexNAc(3)Kdn(1) |
S, T |
UNIMOD:1711 |
Hex(3) HexNAc(3) NeuAc Sulf |
1466.44882 |
Hex(3)HexNAc(3)NeuAc(1)Sulf(1) |
S, T |
UNIMOD:1712 |
Hex(3)HexNAc(2)NeuAc(2) |
1474.508049 |
Hex(3) HexNAc(2) NeuAc(2) |
S, T |
UNIMOD:1713 |
Hex(3) HexNAc(3) NeuGc Sulf |
1482.443734 |
Hex(3)HexNAc(3)NeuGc(1)Sulf(1) |
S, T |
UNIMOD:1714 |
dHex(1)Hex(2)HexNAc(2)NeuGc(2) |
1490.502964 |
dHex Hex(2) HexNAc(2) NeuGc(2) |
S, T |
UNIMOD:1715 |
dHex(2)Hex(3)HexNAc(2)NeuGc(1) |
1491.523365 |
dHex(2) Hex(3) HexNAc(2) NeuGc —OR— Hex(4) HexNAc(2) dHex NeuAc |
S, T |
UNIMOD:1716 |
dHex Hex(3) HexA HexNAc(3) Sulf |
1497.4434 |
dHex(1)Hex(3)HexA(1)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1717 |
Hex(2)HexNAc(3)NeuAc(2) |
1515.534598 |
Hex(2) HexNAc(3) NeuAc(2) |
S, T |
UNIMOD:1718 |
dHex(2) Hex(2) HexNAc(3) NeuAc |
1516.554999 |
dHex(2)Hex(2)HexNAc(3)NeuAc(1) |
S, T |
UNIMOD:1719 |
dHex(4)Hex(2)HexNAc(3) |
1517.5754 |
dHex(4) Hex(2) HexNAc(3) |
S, T |
UNIMOD:1720 |
Hex(2) HexNAc(3) NeuAc NeuGc |
1531.529513 |
Hex(2)HexNAc(3)NeuAc(1)NeuGc(1) |
S, T |
UNIMOD:1721 |
dHex(2)Hex(2)HexNAc(3)NeuGc(1) |
1532.549914 |
dHex(2) Hex(2) HexNAc(3) NeuGc —OR— Hex(3) HexNAc(3) dHex NeuAc —OR— Hex(2) HexNAc(4) dHex Kdn |
S, T |
UNIMOD:1722 |
dHex(3)Hex(3)HexNAc(3) |
1533.570315 |
dHex(3) Hex(3) HexNAc(3) |
S, T |
UNIMOD:1723 |
Hex(8)Phos(3) |
1536.321581 |
Hex(8) Phos(3) |
S, T |
UNIMOD:1724 |
dHex Hex(2) HexNAc(2) NeuAc(2) Sulf |
1538.469949 |
dHex(1)Hex(2)HexNAc(2)NeuAc(2)Sulf(1) |
S, T |
UNIMOD:1725 |
Hex(2)HexNAc(3)NeuGc(2) |
1547.524427 |
Hex(2) HexNAc(3) NeuGc(2) |
S, T |
UNIMOD:1726 |
dHex(4) Hex(2) HexNAc(2) Kdn |
1564.564895 |
dHex(4)Hex(2)HexNAc(2)Kdn(1) |
S, T |
UNIMOD:1727 |
dHex Hex(2) HexNAc(4) NeuAc |
1573.576463 |
dHex(1)Hex(2)HexNAc(4)NeuAc(1) |
S, T |
UNIMOD:1728 |
dHex(3)Hex(2)HexNAc(4) |
1574.596864 |
dHex(3) Hex(2) HexNAc(4) |
S, T |
UNIMOD:1729 |
Hex HexNAc NeuGc(4) |
1593.493521 |
Hex(1)HexNAc(1)NeuGc(4) |
S, T |
UNIMOD:1730 |
dHex(4) Hex HexNAc(3) Kdn |
1605.591444 |
dHex(4)Hex(1)HexNAc(3)Kdn(1) |
S, T |
UNIMOD:1732 |
Hex(4)HexNAc(4)Sulf(2) |
1620.442414 |
Hex(4) HexNAc(4) Sulf(2) |
S, T |
UNIMOD:1733 |
dHex(3)Hex(2)HexNAc(3)Kdn(1) |
1621.586359 |
dHex(3) Hex(2) HexNAc(3) Kdn —OR— Hex(3) HexNAc(2) dHex(3) NeuAc |
S, T |
UNIMOD:1735 |
dHex(2)Hex(2)HexNAc(5) |
1631.618328 |
dHex(2) Hex(2) HexNAc(5) |
S, T |
UNIMOD:1736 |
dHex(2) Hex(3) HexA HexNAc(3) Sulf |
1643.501309 |
dHex(2)Hex(3)HexA(1)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1737 |
dHex Hex(4) HexA HexNAc(3) Sulf |
1659.496223 |
dHex(1)Hex(4)HexA(1)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1738 |
Hex(3)HexNAc(3)NeuAc(2) |
1677.587422 |
Hex(3) HexNAc(3) NeuAc(2) |
S, T |
UNIMOD:1739 |
dHex(2)Hex(3)HexNAc(3)NeuAc(1) |
1678.607823 |
dHex(2) Hex(3) HexNAc(3) NeuAc —OR— Hex(2) HexNAc(4) dHex(2) Kdn |
S, T |
UNIMOD:1740 |
dHex(4)Hex(3)HexNAc(3) |
1679.628224 |
dHex(4) Hex(3) HexNAc(3) |
S, T |
UNIMOD:1742 |
Hex(9)Phos(3) |
1698.374404 |
Hex(9) Phos(3) |
S, T |
UNIMOD:1743 |
dHex(2)HexNAc(7) |
1713.671426 |
dHex(2) HexNAc(7) |
S, T |
UNIMOD:1744 |
Hex(2) HexNAc NeuGc(4) |
1755.546345 |
Hex(2)HexNAc(1)NeuGc(4) |
S, T |
UNIMOD:1745 |
Hex(3) HexNAc(3) NeuAc(2) Sulf |
1757.544236 |
Hex(3)HexNAc(3)NeuAc(2)Sulf(1) |
S, T |
UNIMOD:1746 |
dHex(2)Hex(3)HexNAc(5) |
1793.671151 |
dHex(2) Hex(3) HexNAc(5) |
S, N, T |
UNIMOD:1747 |
dHex Hex(2) HexNAc(2) NeuGc(3) |
1797.593295 |
dHex(1)Hex(2)HexNAc(2)NeuGc(3) |
S, T |
UNIMOD:1748 |
dHex(2) Hex(4) HexA HexNAc(3) Sulf |
1805.554132 |
dHex(2)Hex(4)HexA(1)HexNAc(3)Sulf(1) |
S, T |
UNIMOD:1749 |
Hex(2)HexNAc(3)NeuAc(3) |
1806.630015 |
Hex(2) HexNAc(3) NeuAc(3) |
S, T |
UNIMOD:1750 |
dHex(1)Hex(3)HexNAc(3)NeuAc(2) |
1823.64533 |
dHex Hex(3) HexNAc(3) NeuAc(2) |
S, T |
UNIMOD:1751 |
dHex(3)Hex(3)HexNAc(3)NeuAc(1) |
1824.665732 |
dHex(3) Hex(3) HexNAc(3) NeuAc |
S, T |
UNIMOD:1752 |
Hex(2)HexNAc(3)NeuGc(3) |
1854.614759 |
Hex(2) HexNAc(3) NeuGc(3) |
S, T |
UNIMOD:1753 |
Hex(10)Phos(3) |
1860.427228 |
Hex(10) Phos(3) |
S, T |
UNIMOD:1754 |
dHex(1)Hex(2)HexNAc(4)NeuAc(2) |
1864.67188 |
dHex Hex(2) HexNAc(4) NeuAc(2) |
S, T |
UNIMOD:1755 |
Hex HexNAc NeuGc(5) |
1900.583852 |
Hex(1)HexNAc(1)NeuGc(5) |
S, T |
UNIMOD:1756 |
Hex(4) HexNAc(4) NeuAc Sulf(2) |
1911.53783 |
Hex(4)HexNAc(4)NeuAc(1)Sulf(2) |
S, T |
UNIMOD:1757 |
Hex(4) HexNAc(4) NeuGc Sulf(2) |
1927.532745 |
Hex(4)HexNAc(4)NeuGc(1)Sulf(2) |
S, T |
UNIMOD:1758 |
dHex(2)Hex(3)HexNAc(3)NeuAc(2) |
1969.703239 |
dHex(2) Hex(3) HexNAc(3) NeuAc(2) |
S, T |
UNIMOD:1759 |
Hex(4)HexNAc(4)NeuAc(1)Sulf(3) |
1991.494645 |
Hex(4) HexNAc(4) NeuAc Sulf(3) |
S, T |
UNIMOD:1760 |
dHex(2)Hex(2)HexNAc(2) |
1022.38021 |
dHex(2) Hex(2) HexNAc(2) |
S, N, T |
UNIMOD:1761 |
dHex Hex(3) HexNAc(2) |
1038.375125 |
dHex(1)Hex(3)HexNAc(2) |
S, N, T |
UNIMOD:1762 |
dHex Hex(2) HexNAc(3) |
1079.401674 |
dHex(1)Hex(2)HexNAc(3) |
S, N, T |
UNIMOD:1763 |
Hex(3)HexNAc(3) |
1095.396588 |
Hex(3) HexNAc(3) |
S, N, T |
UNIMOD:1764 |
dHex Hex(3) HexNAc(2) Sulf |
1118.331939 |
dHex(1)Hex(3)HexNAc(2)Sulf(1) |
S, N, T |
UNIMOD:1765 |
dHex(2)Hex(3)HexNAc(2) |
1184.433033 |
dHex(2) Hex(3) HexNAc(2) |
S, N, T |
UNIMOD:1766 |
dHex Hex(4) HexNAc(2) |
1200.427948 |
dHex(1)Hex(4)HexNAc(2) |
S, N, T |
UNIMOD:1767 |
dHex(2)Hex(2)HexNAc(3) |
1225.459583 |
dHex(2) Hex(2) HexNAc(3) |
S, N, T |
UNIMOD:1768 |
dHex Hex(3) HexNAc(3) |
1241.454497 |
dHex(1)Hex(3)HexNAc(3) |
S, N, T |
UNIMOD:1769 |
Hex(4)HexNAc(3) |
1257.449412 |
Hex(4) HexNAc(3) |
S, N, T |
UNIMOD:1770 |
dHex(2)Hex(4)HexNAc(2) |
1346.485857 |
dHex(2) Hex(4) HexNAc(2) |
S, N, T |
UNIMOD:1771 |
dHex(2)Hex(3)HexNAc(3) |
1387.512406 |
dHex(2) Hex(3) HexNAc(3) |
S, N, T |
UNIMOD:1772 |
A3 |
1501.555334 |
Hex(3)HexNAc(5) |
S, N, T |
UNIMOD:1773 |
Hex(4)HexNAc(3)NeuAc(1) |
1548.544828 |
Hex(4) HexNAc(3) NeuAc —OR— Hex(3) HexNAc(4) Kdn |
S, N, T |
UNIMOD:1774 |
dHex(2)Hex(3)HexNAc(4) |
1590.591779 |
dHex(2) Hex(3) HexNAc(4) |
S, N, T |
UNIMOD:1775 |
dHex Hex(3) HexNAc(5) |
1647.613242 |
dHex(1)Hex(3)HexNAc(5) |
S, N, T |
UNIMOD:1776 |
A4 |
1704.634706 |
Hex(3)HexNAc(6) |
S, N, T |
UNIMOD:1777 |
Hex(4) HexNAc(4) NeuAc |
1751.624201 |
Hex(4)HexNAc(4)NeuAc(1) |
S, N, T |
UNIMOD:1778 |
dHex(2)Hex(4)HexNAc(4) |
1752.644602 |
dHex(2) Hex(4) HexNAc(4) —OR— Hex(4) HexNAc(4) dHex Pent Me |
S, N, T |
UNIMOD:1779 |
Hex(6)HexNAc(4) |
1784.634431 |
Hex(6) HexNAc(4) |
S, N, T |
UNIMOD:1780 |
Hex(5)HexNAc(5) |
1825.660981 |
Hex(5) HexNAc(5) |
S, N, T |
UNIMOD:1781 |
dHex Hex(3) HexNAc(6) |
1850.692615 |
dHex(1)Hex(3)HexNAc(6) |
S, N, T |
UNIMOD:1782 |
dHex(1)Hex(4)HexNAc(4)NeuAc(1) |
1897.68211 |
dHex Hex(4) HexNAc(4) NeuAc —OR— Hex(3) HexNAc(5) dHex Kdn |
S, N, T |
UNIMOD:1783 |
dHex(3)Hex(4)HexNAc(4) |
1898.702511 |
dHex(3) Hex(4) HexNAc(4) |
S, N, T |
UNIMOD:1784 |
dHex Hex(3) HexNAc(5) NeuAc |
1938.708659 |
dHex(1)Hex(3)HexNAc(5)NeuAc(1) |
S, N, T |
UNIMOD:1785 |
dHex(2)Hex(4)HexNAc(5) |
1955.723975 |
dHex(2) Hex(4) HexNAc(5) |
S, N, T |
UNIMOD:1786 |
Ac Hex HexNAc NeuAc |
698.238177 |
Hex(1)HexNAc(1)NeuAc(1)Ac(1) |
S, T |
UNIMOD:1787 |
K4 |
4.00078 |
13C(2) 15N(2), Label:13C(2)15N(2) |
K |
UNIMOD:1789 |
Xlink:DSS[155] |
155.094629 |
Ammonium-quenched monolink of DSS/BS3 crosslinker |
N-term, K |
UNIMOD:1799 |
NQIGG |
469.228496 |
SUMOylation by Giardia lamblia |
K |
UNIMOD:1800 |
Carboxyethylpyrrole |
122.036779 |
K |
|
UNIMOD:1801 |
Fluorescein-tyramine |
493.116152 |
Fluorescein-tyramine adduct by peroxidase activity |
Y |
UNIMOD:1824 |
GEE |
86.036779 |
transamidation of glycine ethyl ester to glutamine |
Q |
UNIMOD:1825 |
RNPXL |
324.035867 |
Simulate peptide-RNA conjugates |
K @ N-term, R @ N-term |
UNIMOD:1826 |
Glu->pyro-Glu+Methyl |
-3.994915 |
Pyro-Glu from E + Methylation |
E @ N-term |
UNIMOD:1827 |
Glu->pyro-Glu+Methyl:2H(2)13C(1) |
-0.979006 |
Pyro-Glu from E + Methylation Medium |
E @ N-term |
UNIMOD:1828 |
LRGG+methyl |
397.243753 |
LRGG ubiquitin remnant with methylated Arg, LeumethylArgGlyGly |
K |
UNIMOD:1829 |
LRGG+dimethyl |
411.259403 |
LeudimethylArgGlyGly, LRGG ubiquitin remnant with dimethylated Arg |
K |
UNIMOD:1830 |
Biotin-Phenol |
361.146012 |
Biotin-tyramide |
Y |
UNIMOD:1831 |
Tris |
104.071154 |
tris adduct at asparagine, tris adduct causes 104 Da addition at asparagine-succinimide intermediate, tris adduct at IgG causes 104 Da addition |
N |
UNIMOD:1832 |
IASD |
452.034807 |
Iodoacetamide derivative of stilbene (reaction product with thiol), 4-acetamido-4’-((iodoacetyl)amino)stilbene-2,2’-disulfonic acid |
C |
UNIMOD:1833 |
NP40 |
220.182715 |
NP-40 synthetic polymer terminus |
N-term |
UNIMOD:1834 |
Tween20 |
165.164326 |
Tween 20 synthetic polymer terminus |
N-term |
UNIMOD:1835 |
Tween80 |
263.237491 |
Tween 80 synthetic polymer terminus |
C-term |
UNIMOD:1836 |
Triton |
188.156501 |
Triton synthetic polymer terminus |
C-term, N-term |
UNIMOD:1837 |
Brij35 |
168.187801 |
Brij 35 synthetic polymer terminus |
N-term |
UNIMOD:1838 |
Brij58 |
224.250401 |
Brij 58 synthetic polymer terminus |
N-term |
UNIMOD:1839 |
betaFNA |
454.210387 |
beta-Funaltrexamine |
K, C |
UNIMOD:1840 |
dHex(1)Hex(7)HexNAc(4) |
2092.745164 |
Fucosylated biantennary + 2 alphaGal |
N |
UNIMOD:1841 |
Biotin:Thermo-21328 |
389.090154 |
also Biotin:Thermo-21331, EZ-Link Sulfo-NHS-SS-Biotin |
N-term, K |
UNIMOD:1842 |
Xlink:DSSO |
158.003765 |
disuccinimidyl sulfoxide CID cleavable cross-link |
N-term, K |
UNIMOD:1843 |
CMP |
305.041287 |
Cytidine monophosphate, PhosphoCytidine |
S, Y, T |
UNIMOD:1844 |
Xlink:EGS |
226.047738 |
Ethylene glycolbis(succinimidylsuccinate), EGS cross-linker |
N-term, K |
UNIMOD:1845 |
AzidoF |
41.001397 |
Azidophenylalanine |
F |
UNIMOD:1846 |
Dimethylaminoethyl |
71.073499 |
Cys alkylation by dimethylaminoethyl halide |
C |
UNIMOD:1848 |
Glutarylation |
114.031694 |
Gluratylation |
K |
UNIMOD:1849 |
hydroxyisobutyryl |
86.036779 |
2-hydroxyisobutanoyl, 3-hydroxybutanoyl, 2-hydroxyisobutyrylation |
K |
UNIMOD:1868 |
MeMePhosphorothioate |
107.979873 |
S-Methyl Methyl phosphorothioate |
S |
UNIMOD:1870 |
Cation:Fe[III] |
52.911464 |
Replacement of 3 protons by iron |
D, C-term, E |
UNIMOD:1871 |
DTT |
151.996571 |
DTT adduct of cysteine |
C |
UNIMOD:1872 |
DYn-2 |
161.09664 |
Sulfenic Acid specific probe |
C |
UNIMOD:1873 |
MesitylOxide |
98.073165 |
Acetone chemical artifact |
N-term, K, H |
UNIMOD:1875 |
methylol |
30.010565 |
formaldehyde induced modifications |
W, K, Y |
UNIMOD:1876 |
Xlink:DSS |
138.06808 |
disuccinimidyl suberate (DSS), bis[sulfosuccinimidyl] suberate (BS3) |
N-term, K |
UNIMOD:1877 |
Xlink:DSS[259] |
259.141973 |
Tris-quenched monolink of DSS/BS3 crosslinker |
N-term, K |
UNIMOD:1878 |
Xlink:DSSO[176] |
176.01433 |
Water-quenched monolink of DSSO crosslinker |
N-term, K |
UNIMOD:1879 |
Xlink:DSSO[175] |
175.030314 |
Ammonia-quenched monolink of DSSO crosslinker |
N-term, K |
UNIMOD:1880 |
Xlink:DSSO[279] |
279.077658 |
Tris-quenched monolink of DSSO crosslinker |
N-term, K |
UNIMOD:1881 |
Xlink:DSSO[54] |
54.010565 |
Alkene fragment of DSSO crosslinker |
N-term, K |
UNIMOD:1882 |
Xlink:DSSO[86] |
85.982635 |
Thiol fragment of DSSO crosslinker |
N-term, K |
UNIMOD:1883 |
Xlink:DSSO[104] |
103.9932 |
Sulfenic acid fragment of DSSO crosslinker |
N-term, K |
UNIMOD:1884 |
Xlink:BuUrBu |
196.084792 |
Also known as DSBU, disuccinimidyl dibutyric urea CID cleavable cross-link |
N-term, K |
UNIMOD:1885 |
Xlink:BuUrBu[111] |
111.032028 |
BuUr fragment of BuUrBu crosslinker |
N-term, K |
UNIMOD:1886 |
Xlink:BuUrBu[85] |
85.052764 |
Bu fragment of BuUrBu crosslinker |
N-term, K |
UNIMOD:1887 |
Xlink:BuUrBu[213] |
213.111341 |
Ammonia quenched monolink of BuUrBu crosslinker |
N-term, K |
UNIMOD:1888 |
Xlink:BuUrBu[214] |
214.095357 |
Water quenched monolink of BuUrBu crosslinker |
N-term, K |
UNIMOD:1889 |
Xlink:BuUrBu[317] |
317.158686 |
Tris quenched monolink of BuUrBu crosslinker |
N-term, K |
UNIMOD:1891 |
Xlink:DTBP |
172.01289 |
dimethyl 3,3'-dithiobispropionimidate |
N-term, K |
UNIMOD:1892 |
Xlink:DST |
113.995309 |
Disuccinimidyl tartrate crosslinker |
N-term, K |
UNIMOD:1893 |
Xlink:DTSSP |
173.980921 |
dithiobis[succinimidylpropionate], Also known as DSP |
N-term, K |
UNIMOD:1895 |
Xlink:SMCC |
219.089543 |
succinimidyl 4-[N-maleimidomethyl]cyclohexane-1-carboxylate |
N-term, K, C |
UNIMOD:1896 |
Xlink:DSSO[158] |
158.003765 |
Intact DSSO crosslinker |
N-term, K |
UNIMOD:1897 |
Xlink:EGS[226] |
226.047738 |
Ethylene glycolbis(succinimidylsuccinate), Intact EGS cross-linker |
N-term, K |
UNIMOD:1898 |
Xlink:DSS[138] |
138.06808 |
Intact DSS/BS3 crosslinker |
N-term, K |
UNIMOD:1899 |
Xlink:BuUrBu[196] |
196.084792 |
Intact BuUrBu crosslinker |
N-term, K |
UNIMOD:1900 |
Xlink:DTBP[172] |
172.01289 |
Intact DTBP crosslinker, dimethyl 3,3’-dithiobispropionimidate |
N-term, K |
UNIMOD:1901 |
Xlink:DST[114] |
113.995309 |
Intact DST crosslinker |
N-term, K |
UNIMOD:1902 |
Xlink:DTSSP[174] |
173.980921 |
Intact DSP/DTSSP crosslinker, Also known as DSP |
N-term, K |
UNIMOD:1903 |
Xlink:SMCC[219] |
219.089543 |
Intact SMCC cross-link |
N-term, K, C |
UNIMOD:1905 |
Xlink:BS2G[96] |
96.021129 |
Intact BS2-G crosslinker |
N-term, K |
UNIMOD:1906 |
Xlink:BS2G[113] |
113.047679 |
Ammonium-quenched monolink of BS2-G crosslinker |
N-term, K |
UNIMOD:1907 |
Xlink:BS2G[114] |
114.031694 |
Water-quenched monolink of BS2-G crosslinker |
N-term, K |
UNIMOD:1908 |
Xlink:BS2G[217] |
217.095023 |
Tris-quenched monolink of BS2-G crosslinker |
N-term, K |
UNIMOD:1909 |
Xlink:BS2G |
96.021129 |
bis[sulfosuccinimidyl] glutarate |
N-term, K |
UNIMOD:1910 |
Cation:Al[III] |
23.958063 |
Replacement of 3 protons by aluminium |
D, C-term, E |
UNIMOD:1911 |
Xlink:DMP[139] |
139.110947 |
Dimethyl pimelimidate dead-end crosslink, Ammonia quenched monolink of DMP crosslinker |
N-term, K |
UNIMOD:1912 |
Xlink:DMP[122] |
122.084398 |
Intact DMP crosslinker, Dimethyl pimelimidate |
N-term, K |
UNIMOD:1913 |
glyoxalAGE |
21.98435 |
glyoxal-derived AGE |
R |
UNIMOD:1914 |
Met->AspSA |
-32.008456 |
Methionine oxidation to aspartic semialdehyde |
M |
UNIMOD:1915 |
Decarboxylation |
-30.010565 |
D, E |
|
UNIMOD:1916 |
Aspartylurea |
-10.031969 |
H |
|
UNIMOD:1917 |
Formylasparagine |
4.97893 |
In Bachi as Formylaspargine (typo?) |
H |
UNIMOD:1918 |
Carbonyl |
13.979265 |
aldehyde and ketone modifications |
V, A, S, R, E, I, Q, L |
UNIMOD:1920 |
AFB1_Dialdehyde |
310.047738 |
adduction of aflatoxin B1 Dialdehyde to lysine |
K |
UNIMOD:1922 |
Pro->HAVA |
18.010565 |
Proline oxidation to 5-hydroxy-2-aminovaleric acid |
P |
UNIMOD:1923 |
Delta:H(-4)O(2) |
27.958529 |
Tryptophan oxidation to beta-unsaturated-2,4-bis-tryptophandione |
W |
UNIMOD:1924 |
Delta:H(-4)O(3) |
43.953444 |
Tryptophan oxidation to hydroxy-bis-tryptophandione |
W |
UNIMOD:1925 |
Delta:O(4) |
63.979659 |
Tryptophan oxidation to dihydroxy-N-formaylkynurenine |
W |
UNIMOD:1926 |
Delta:H(4)C(3)O(2) |
72.021129 |
methylglyoxal-derived carboxyethyllysine |
K |
UNIMOD:1927 |
Delta:H(4)C(5)O(1) |
80.026215 |
methylglyoxal-derived argpyrimidine |
R |
UNIMOD:1928 |
Delta:H(10)C(8)O(1) |
122.073165 |
crotonaldehyde-derived dimethyl-FDP-lysine |
K |
UNIMOD:1929 |
Delta:H(6)C(7)O(4) |
154.026609 |
methylglyoxal-derived tetrahydropyrimidine |
R |
UNIMOD:1930 |
Pent(2) |
264.084518 |
S, T |
|
UNIMOD:1931 |
Pent HexNAc |
335.121631 |
Pent(1)HexNAc(1) |
S, T |
UNIMOD:1932 |
Hex(2)Sulf(1) |
404.062462 |
Hex(2) O(3) S |
S, T |
UNIMOD:1933 |
Hex:1 Pent:2 Me:1 |
440.152991 |
Hex(1)Pent(2)Me(1) |
S, T |
UNIMOD:1934 |
HexNAc(2) Sulf |
486.11556 |
HexNAc(2)Sulf(1) |
S, T |
UNIMOD:1935 |
Hex Pent(3) Me |
572.19525 |
Hex(1)Pent(3)Me(1) |
S, T |
UNIMOD:1936 |
Hex(2)Pent(2) |
588.190165 |
Hex(2) Pent(2) |
S, T |
UNIMOD:1937 |
Hex(2) Pent(2) Me |
602.205815 |
Hex(2)Pent(2)Me(1) |
S, T |
UNIMOD:1938 |
Hex(4) HexA |
824.243382 |
Hex(4)HexA(1) |
S, T |
UNIMOD:1939 |
Hex(2) HexNAc Pent HexA |
835.259366 |
Hex(2)HexNAc(1)Pent(1)HexA(1) |
S, T |
UNIMOD:1940 |
Hex(3) HexNAc HexA |
865.269931 |
Hex(3)HexNAc(1)HexA(1) |
S, T |
UNIMOD:1941 |
Hex HexNAc(2) dHex(2) Sulf |
940.284201 |
Hex(1)HexNAc(2)dHex(2)Sulf(1) |
S, T |
UNIMOD:1942 |
HexA(2)HexNAc(3) |
961.302294 |
HexA(2) HexNAc(3) |
S, T |
UNIMOD:1943 |
dHex Hex(4) HexA |
970.301291 |
dHex(1)Hex(4)HexA(1) |
S, T |
UNIMOD:1944 |
Hex(5) HexA |
986.296206 |
Hex(5)HexA(1) |
S, T |
UNIMOD:1945 |
Hex(4) HexA HexNAc |
1027.322755 |
Hex(4)HexA(1)HexNAc(1) |
S, T |
UNIMOD:1946 |
dHex(3) Hex(3) HexNAc |
1127.41157 |
dHex(3)Hex(3)HexNAc(1) |
S, T |
UNIMOD:1947 |
Hex(6) HexNAc |
1175.396314 |
Hex(6)HexNAc(1) |
N |
UNIMOD:1948 |
Sulf dHex Hex HexNAc(4) |
1200.385037 |
Hex(1)HexNAc(4)dHex(1)Sulf(1) |
S, T |
UNIMOD:1949 |
dHex Hex(2) HexNAc NeuAc(2) |
1255.433762 |
dHex(1)Hex(2)HexNAc(1)NeuAc(2) |
S, T |
UNIMOD:1950 |
dHex(3)Hex(3)HexNAc(2) |
1330.490942 |
dHex(3) Hex(3) HexNAc(2) |
S, T |
UNIMOD:1951 |
dHex(2) Hex HexNAc(4) Sulf |
1346.442946 |
dHex(2)Hex(1)HexNAc(4)Sulf(1) |
S, T |
UNIMOD:1952 |
dHex Hex(2) HexNAc(4) Sulf(2) |
1442.394675 |
dHex(1)Hex(2)HexNAc(4)Sulf(2) |
S, T |
UNIMOD:1953 |
Hex(9) |
1458.475412 |
N |
|
UNIMOD:1954 |
dHex(2)Hex(3)HexNAc(3)Sulf(1) |
1467.469221 |
Sulf dHex(2) Hex(3) HexNAc(3) |
S, T |
UNIMOD:1955 |
Me dHex(2) Hex(5) HexNAc(2) |
1522.554331 |
dHex(2)Hex(5)HexNAc(2)Me(1) |
S, T |
UNIMOD:1956 |
dHex(2)Hex(2)HexNAc(4)Sulf(2) |
1588.452584 |
Sulf(2) dHex(2) Hex(2) HexNAc(4) |
S, T |
UNIMOD:1957 |
Hex(9) HexNAc |
1661.554784 |
Hex(9)HexNAc(1) |
N |
UNIMOD:1958 |
dHex(3)Hex(2)HexNAc(4)Sulf(2) |
1734.510493 |
dHex(3) Hex(2) HexNAc(4) Sulf(2) |
S, T |
UNIMOD:1959 |
Hex(4) HexNAc(4) NeuGc |
1767.619116 |
Hex(4)HexNAc(4)NeuGc(1) |
S, N, T |
UNIMOD:1960 |
dHex(4)Hex(3)HexNAc(2)NeuAc(1) |
1767.644268 |
dHex(4) Hex(3) HexNAc(2) NeuAc(1) |
S, T |
UNIMOD:1961 |
Hex(3)HexNAc(5)NeuAc(1) |
1792.65075 |
Hex(3) HexNAc(5) NeuAc(1) |
N |
UNIMOD:1962 |
Hex(10)HexNAc(1) |
1823.607608 |
Hex(10) HexNAc(1) |
N |
UNIMOD:1963 |
dHex Hex(8) HexNAc(2) |
1848.639242 |
dHex(1)Hex(8)HexNAc(2) |
N |
UNIMOD:1964 |
Hex(3)HexNAc(4)NeuAc(2) |
1880.666794 |
Hex(3) HexNAc(4) NeuAc(2) |
N |
UNIMOD:1965 |
dHex(2)Hex(3)HexNAc(4)NeuAc(1) |
1881.687195 |
dHex(2) Hex(3) HexNAc(4) NeuAc |
N |
UNIMOD:1966 |
dHex(2) Hex(2) HexNAc(6) Sulf |
1914.654515 |
dHex(2)Hex(2)HexNAc(6)Sulf(1) |
S, T |
UNIMOD:1967 |
Hex(5) HexNAc(4) NeuAc Ac |
1955.687589 |
Hex(5)HexNAc(4)NeuAc(1)Ac(1) |
N |
UNIMOD:1968 |
Hex(3)HexNAc(3)NeuAc(3) |
1968.682838 |
Hex(3) HexNAc(3) NeuAc(3) |
S, T |
UNIMOD:1969 |
Hex(5) HexNAc(4) NeuAc Ac(2) |
1997.698154 |
Hex(5)HexNAc(4)NeuAc(1)Ac(2) |
N |
UNIMOD:1970 |
Unknown:162 |
162.125595 |
The elemental composition should be assumed incorrect, Unidentified modification of 162.1258 found in open search, Although it happens to be that of Diethylene glycol butyl ether, a common solvent. |
D, N-term, C-term, E |
UNIMOD:1971 |
Unknown:177 |
176.744957 |
The elemental composition should be assumed incorrect, Unidentified modification of 176.7462 found in open search |
D, N-term, C-term, E |
UNIMOD:1972 |
Unknown:210 |
210.16198 |
Unidentified modification of 210.1616 found in open search, The elemental composition should be assumed incorrect |
D, N-term, C-term, E |
UNIMOD:1973 |
Unknown:216 |
216.099774 |
Unidentified modification of 216.1002 found in open search, The elemental composition should be assumed incorrect |
D, N-term, C-term, E |
UNIMOD:1974 |
Unknown:234 |
234.073953 |
Unidentified modification of 234.0742 found in open search, The elemental composition should be assumed incorrect |
D, N-term, C-term, E |
UNIMOD:1975 |
Unknown:248 |
248.19876 |
The elemental composition should be assumed incorrect, Unidentified modification of 248.1986 found in open search |
D, N-term, C-term, E |
UNIMOD:1976 |
Unknown:250 |
249.981018 |
Unidentified modification of 249.981 found in open search, The elemental composition should be assumed incorrect |
D, N-term, C-term, E |
UNIMOD:1977 |
Unknown:302 |
301.986514 |
Unidentified modification of 301.9864 found in open search, The elemental composition should be assumed incorrect |
D, N-term, C-term, E |
UNIMOD:1978 |
Unknown:306 |
306.095082 |
The elemental composition should be assumed incorrect, Unidentified modification of 306.0952 found in open search |
D, N-term, C-term, E |
UNIMOD:1979 |
Unknown:420 |
420.051719 |
Unidentified modification of 420.0506 found in open search, Probable non-covalent adduct of CAM-DTT-DTT-CAM |
C-term, N-term |
UNIMOD:1986 |
Diethylphosphothione |
152.006087 |
O-diethylphosphothione |
H, C, K, S, T, Y |
UNIMOD:1987 |
O-ethylphosphothione |
123.974787 |
Dimethylphosphothione, O-dimethylphosphothione |
H, C, K, S, T, Y |
UNIMOD:1989 |
O-methylphosphothione |
109.959137 |
monomethylphosphothione |
H, C, K, S, T, Y |
UNIMOD:1990 |
CIGG |
330.136176 |
Ubiquitin D (FAT10) leaving after chymotrypsin digestion Cys-Ile-Gly-Gly |
K |
UNIMOD:1991 |
GNLLFLACYCIGG |
1324.6308 |
Ubiquitin D (FAT10) leaving after trypsin digestion Gly-Asn-Leu-Leu-Phe-Leu-Ala-Cys-Tyr-Cys-Ile-Gly-Gly |
K |
UNIMOD:1992 |
serotonylation |
159.068414 |
5-glutamyl serotonin |
Q |
UNIMOD:1993 |
TMPP-Ac:13C(9) |
581.211328 |
heavy tris(2,4,6-trimethoxyphenyl)phosphonium acetic acid N-hydroxysuccinimide ester derivative |
N-term, K, Y |
UNIMOD:1999 |
Xlink:DST[56] |
55.989829 |
DST crosslinker cleaved by sodium periodate |
N-term, K |
UNIMOD:2000 |
Xlink:SDA |
82.041865 |
NHS-Diazirine crosslinker |
N-term, K |
UNIMOD:2001 |
ZQG |
320.100836 |
carbobenzoxy-L-glutaminyl-glycine |
K |
UNIMOD:2006 |
Haloxon |
203.950987 |
O-Dichloroethylphosphate |
H, C, K, S, T, Y |
UNIMOD:2007 |
Methamidophos-S |
108.975121 |
S-methyl amino phosphinate |
H, C, K, S, T, Y |
UNIMOD:2008 |
Methamidophos-O |
92.997965 |
O-methyl amino phosphinate |
H, C, K, S, T, Y |
UNIMOD:2014 |
Nitrene |
12.995249 |
Loss of O2; nitro photochemical decomposition |
Y |
UNIMOD:2015 |
shTMT |
235.176741 |
Super Heavy Tandem Mass Tag, Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc., Super Heavy TMT |
N-term, K |
UNIMOD:2016 |
TMTpro |
304.207146 |
Also applies to TMTpro 18plex mass tags, TMTpro 16plex Tandem Mass Tag, Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc. |
H, N-term, K, S, T |
UNIMOD:2017 |
TMTpro_zero |
295.189592 |
Native TMTpro Tandem Mass Tag, Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc. |
H, N-term, K, S, T |
UNIMOD:2018 |
Xlink:EDC |
-18.010565 |
1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride, carbodiimide crosslinker |
C-term, N-term, K, D, E |
UNIMOD:2020 |
Xlink:Disulfide |
-2.01565 |
Intact disulfide bridge |
C |
UNIMOD:2022 |
Ser/Thr-KDO |
220.058303 |
2-Keto-3-Deoxy-D-Mannooctanoic Acid, Glycosylation of Serine/Threonine residues with KDO, 3-deoxy-D-manno-oct-2-ulosonic acid |
S, T |
UNIMOD:2025 |
Andro-H2O |
332.19876 |
andrographolide with the loss of H2O |
C |
UNIMOD:2026 |
Xlink:KQisopeptide |
-17.026549 |
transglutamination, Isopeptide bond formation with loss of ammonia |
Q, K |
UNIMOD:2027 |
His+O(2) |
169.048741 |
Photo-induced histidine adduct |
H |
UNIMOD:2028 |
A3G3S3 |
2861.000054 |
Hex(6)HexNAc(5)NeuAc(3) |
N |
UNIMOD:2029 |
A4G4 |
2352.846 |
Hex(7)HexNAc(6) |
S, N, T |
UNIMOD:2033 |
Met+O(2) |
163.030314 |
Photo-induced Methionine Adduct |
H |
UNIMOD:2034 |
Gly+O(2) |
89.011293 |
Photo-induced Glycine Adduct |
H |
UNIMOD:2035 |
Pro+O(2) |
129.042593 |
Photo-induced Proline adduct |
H |
UNIMOD:2036 |
Lys+O(2) |
160.084792 |
Photo-induced Lysine adduct |
H |
UNIMOD:2037 |
Glu+O(2) |
161.032422 |
Photo-induced Glutamate adduct |
H |
UNIMOD:2039 |
LTX+Lophotoxin |
416.147118 |
addition of lophotoxin to tyrosine |
Y |
UNIMOD:2040 |
MBS+peptide |
1482.77 |
MBS_233p24 plus peptide 1250p53 |
C |
UNIMOD:2041 |
3-hydroxybenzyl-phosphate |
186.008196 |
3-hydroxybenzyl phosphate |
S, K, T, Y |
UNIMOD:2042 |
phenyl-phosphate |
155.997631 |
phenyl phosphate |
S, K, T, Y |
UNIMOD:2044 |
RBS-ID_Uridine |
244.069536 |
RNA-protein UVC-crosslinked, hydrofluoride-digested uridine adduct |
Y |
UNIMOD:2050 |
shTMTpro |
313.231019 |
Super Heavy TMTpro, 13C15 H25 15N3 O3, Tandem Mass Tag and TMT are registered Trademarks of Proteome Sciences plc., TMTpro-SH |
N-term, K |
UNIMOD:2052 |
Biotin:Aha-DADPS |
922.465403 |
Intact DADPS Biotin Alkyne tag |
M |
UNIMOD:2053 |
Biotin:Aha-PC |
690.24316 |
Intact PC Biotin Alkyne tag |
M |
UNIMOD:2054 |
pRBS-ID_4-thiouridine |
226.058972 |
RNA-protein UVA-crosslinked, hydrofluoride-digested 4-thiouridine adduct |
F |
UNIMOD:2055 |
pRBS-ID_6-thioguanosine |
265.081104 |
RNA-protein UVA-crosslinked, hydrofluoride-digested 6-thioguanosine adduct |
W |
UNIMOD:2057 |
A52285 |
221.081695 |
Iodoacetamido-LC-Phosphonic Acid derivative, 6C-CysPAT, Carbamido-LC-phosphoyrlation |
H, C, N-term, K, D, S, T, E, Y |
UNIMOD:2058 |
A52286, A52287 |
209.97181 |
Xlink:DSPP[210], PhoX, tBu-PhoX (acid deprotected), Intact DSPP/TBDSPP crosslinker |
N-term, K |
UNIMOD:2060 |
C12 H14 N O8 P |
331.045704 |
A52286, A52287, Tris-quenched monolink of DSPP/TBDSPP crosslinker, Xlink:DSPP[331], PhoX, tBu-PhoX (acid deprotected) Tris quench |
N-term, K |
UNIMOD:2062 |
DBIA |
296.184841 |
desthiobiotinylation of cysteine with DBIA probe |
C |
UNIMOD:2067 |
Mono_Nγ-propargyl-L-Gln_desthiobiotin |
580.333296 |
Enrichment of modified peptides using desthiobiotin-tag on streptavidin beads, Monomodification of Nγ-propargyl-L-Gln probe with clicked desthiobiotin-azide |
D, E |
UNIMOD:2068 |
Di_L-Glu_Nγ-propargyl-L-Gln_desthiobiotin |
709.375889 |
Dimodification of L-Glu and Nγ-propargyl-L-Gln probe with clicked desthiobiotin-azide |
D, E |
UNIMOD:2069 |
Di_L-Gln_Nγ-propargyl-L-Gln_desthiobiotin |
708.391873 |
Dimodification of L-Gln and Nγ-propargyl-L-Gln probe with clicked desthiobiotin-azide |
D, E |
UNIMOD:2070 |
L-Gln |
128.058578 |
Monomodification with glutamine |
D, E |
UNIMOD:2072 |
Glyceroyl |
88.016044 |
Glyceroylation |
N-term, K |
Targeting Rules¶
When specifying modification target restrictions, following a modification rule’s name, write (<target>) where <target>
may be a series of amino acids or peptide terminals N-term or C-term or <AA> @ <terminal>, e.g. Deamidated (N)
to specify the Deamidated modification rule on asparagine.